Lus10003693 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001579 184 / 3e-58 AT2G40920 67 / 6e-12 F-box and associated interaction domains-containing protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G093100 56 / 7e-10 AT1G50870 80 / 2e-16 F-box and associated interaction domains-containing protein (.1)
PFAM info
Representative CDS sequence
>Lus10003693 pacid=23179488 polypeptide=Lus10003693 locus=Lus10003693.g ID=Lus10003693.BGIv1.0 annot-version=v1.0
ATGGTCGAAACCGTGACGCATCAGGATTGCTTGATCATATGGATTCTTGCTGACCAGAAGAGCAGCCACTGGGTGAAGCGAGAAGTCATCACGCTGCCTT
GTTTCGGAGAAGGATTCGCCATCGGAGACATCAAGGCGTTCTGGAGCGACAGGATCCTGCTGAGCTCGGCTGACAATGTGATGATCTTCTATAATCCTCG
GAGTAGGACGTTCAAGAAAGTGAAGGTTCCAGAAGGCTTGGAGAACTGCGGTTCCAGCCTTTACGCCGAAAGTCTCTGTGACCTTACGAGCCCCGGCTTA
ATAAGGGGTTCAGAGAACGGAGTTCATAAATATAGTAGTGGAGAAATTAGTTACTGCCGGAATGTGTTTCGAAAAATCATGTAG
AA sequence
>Lus10003693 pacid=23179488 polypeptide=Lus10003693 locus=Lus10003693.g ID=Lus10003693.BGIv1.0 annot-version=v1.0
MVETVTHQDCLIIWILADQKSSHWVKREVITLPCFGEGFAIGDIKAFWSDRILLSSADNVMIFYNPRSRTFKKVKVPEGLENCGSSLYAESLCDLTSPGL
IRGSENGVHKYSSGEISYCRNVFRKIM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003693 0 1
AT2G39350 ABCG1 ATP-binding cassette G1, ABC-2... Lus10033663 2.2 0.7704
AT4G23470 PLAC8 family protein (.1.2.3) Lus10005117 4.5 0.7782
AT5G35390 Leucine-rich repeat protein ki... Lus10017144 7.1 0.7278
AT5G59790 Domain of unknown function (DU... Lus10030328 8.2 0.6561
AT3G05950 RmlC-like cupins superfamily p... Lus10015128 9.1 0.8030
AT1G10010 AAP8, ATAAP8 amino acid permease 8 (.1) Lus10037248 11.1 0.7931
AT1G56580 SVB SMALLER WITH VARIABLE BRANCHES... Lus10033613 11.8 0.7150
AT1G35710 Protein kinase family protein ... Lus10002293 12.0 0.7062
AT4G21380 ARK3 receptor kinase 3 (.1) Lus10027823 12.1 0.6172
AT2G43840 UGT74F1 UDP-glycosyltransferase 74 F1 ... Lus10017825 13.6 0.7366

Lus10003693 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.