Lus10003695 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029003 175 / 4e-52 AT3G49030 57 / 3e-08 FBD, F-box and Leucine Rich Repeat domains containing protein (.1.2)
Lus10001581 157 / 4e-45 AT4G21120 915 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1)
Lus10000650 121 / 6e-34 ND /
Lus10029083 100 / 6e-25 AT1G67390 54 / 6e-08 F-box family protein (.1)
Lus10028940 91 / 6e-23 ND /
Lus10034430 85 / 2e-20 ND /
Lus10034290 79 / 8e-18 AT5G02910 53 / 2e-07 F-box/RNI-like superfamily protein (.1.2)
Lus10037289 71 / 6e-15 AT5G02920 61 / 4e-10 F-box/RNI-like superfamily protein (.1)
Lus10035698 59 / 5e-11 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10003695 pacid=23179470 polypeptide=Lus10003695 locus=Lus10003695.g ID=Lus10003695.BGIv1.0 annot-version=v1.0
ATGCATGTAGTAGCTCCGGTTCCGAGTGTAAAATTCGTAGAGCTTAGACTCGATGAACTGATTTCCAAGTTCCCTTCTCTCGAGTCTCTCCACCTCAGAG
CAACACAGTGCGACAGAAAGCTAAGGATTTCAGCTCATGCGCTCCGGGTACTAACTCTAGGAGACCTATCTTCCAAGACTCCCGCGATCGAGATCGATGC
TCCTAATCTCGTAAAGCTAACCGTCCACACCGTCACTTGGCCCAAAATCAATAAATGGGATGTTGTCAATGTGGCTCCTAGCTGCCGATGTGTGTTTAAT
TGTTCTGTCCCTGAATGCACTGGGGCAACAACAAAACGAAACATAACAACAAACTGGTTTATTGAGCTGAAGAAGTATCTCGCGGTACTAGCTACTCGTT
TTCACCGCCTGGTTTTCGAGTTAAAATTGCCGCAGCGAATAGAGGCTGTTAATGTGTATAAGGATCATTAA
AA sequence
>Lus10003695 pacid=23179470 polypeptide=Lus10003695 locus=Lus10003695.g ID=Lus10003695.BGIv1.0 annot-version=v1.0
MHVVAPVPSVKFVELRLDELISKFPSLESLHLRATQCDRKLRISAHALRVLTLGDLSSKTPAIEIDAPNLVKLTVHTVTWPKINKWDVVNVAPSCRCVFN
CSVPECTGATTKRNITTNWFIELKKYLAVLATRFHRLVFELKLPQRIEAVNVYKDH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003695 0 1
Lus10003774 1.0 1.0000
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10005596 1.4 1.0000
AT4G35260 IDH-I, IDH1 isocitrate dehydrogenase I, is... Lus10014436 1.7 1.0000
AT1G28300 B3 LEC2 LEAFY COTYLEDON 2, AP2/B3-like... Lus10015428 2.0 1.0000
Lus10033071 2.2 1.0000
AT5G53820 Late embryogenesis abundant pr... Lus10007566 2.4 1.0000
AT5G47670 CCAAT NF-YB6, L1L "nuclear factor Y, subunit B6"... Lus10008978 2.6 1.0000
AT3G55700 UDP-Glycosyltransferase superf... Lus10040724 2.8 1.0000
Lus10020958 3.0 1.0000
Lus10021906 3.2 1.0000

Lus10003695 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.