Lus10003703 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G77360 317 / 6e-107 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G71060 179 / 2e-53 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G62540 124 / 8e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G62470 124 / 1e-32 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G14820 124 / 1e-32 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G49730 124 / 2e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G52640 122 / 3e-32 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G20300 120 / 2e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G65820 118 / 2e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G74900 115 / 8e-30 OTP43 organelle transcript processing defect 43, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001588 378 / 4e-129 AT1G77360 679 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001633 156 / 2e-44 AT1G71060 602 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10033591 121 / 3e-33 AT1G77360 121 / 4e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030603 125 / 4e-33 AT1G52640 672 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10017633 123 / 1e-32 AT1G77360 183 / 2e-51 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10011566 122 / 9e-32 AT5G65820 826 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10030887 119 / 3e-31 AT1G52640 658 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10021991 116 / 1e-29 AT5G15010 617 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028520 112 / 3e-28 AT5G37820 215 / 4e-64 NODULIN- 26-LIKE MAJOR INTRINSIC PROTEIN 5, NOD26-like intrinsic protein 4;2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G181900 338 / 2e-115 AT1G77360 723 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G114700 171 / 4e-50 AT1G71060 679 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G102700 129 / 1e-34 AT1G52640 697 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G245400 128 / 3e-34 AT1G20300 768 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.014G121400 126 / 3e-33 AT3G62470 737 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G045800 124 / 6e-33 AT1G77360 192 / 4e-55 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G176100 125 / 8e-33 AT3G49730 783 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.017G126600 120 / 1e-31 AT1G77360 173 / 5e-48 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G053600 113 / 1e-28 AT5G15010 659 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.010G084000 110 / 8e-28 AT3G22670 489 / 3e-168 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10003703 pacid=23179467 polypeptide=Lus10003703 locus=Lus10003703.g ID=Lus10003703.BGIv1.0 annot-version=v1.0
ATGAGGATTCACAGTCAGTTTAGTAAGCTATATTCCTCAAGGCGAGCGTTCTTCATAAGAGGTTATAGTATTAGTACGATTCCTTCAGTATACGAACAAT
CGGATTCAGTCAAAACGATAAGCAAAATAATGATGTCGACCCCAGCTGTAACTCTCGACACAGCCCTAGATCAGAGCGGGGTTCGCATTTCAACCGAAGT
TGTTGAATCCGTGCTCAAGAGATTCGAGAACGCCGGGATGCTTGCATTCCAATTCTTCGAATGGGCCGATAACCACCGCCATTACGATCACAGCATCAGA
GCTTACCATACTATGATCGAGTCGCTTTCCAAGATAAGGCAGTACAGGCTGATGTGGGATCTCGTGAATTCCATGAAGAGCAAGAGGATGTTGAACGTCG
AGACGTTTTGCATCATCATGAGGAAGTATGCTCGAGCTAAGAAGGTCGAAGAAGCTGTGTACGCTTTCAATGTGATGGAGAAGTACGATGTGCCGCAAAA
TTTAGCTGCTTTCAATGGCTTGCTTAGTGCTCTGTGCAAGTCGCAGAATGTGAGGAAAGCTCAGGAATTGTTCGACGGTATGAAGGATAAGTTCGTTCCG
GATTCGAAGACTTATAGTATACTATTGGAAGGATGGGGGAGAGCTCCGGATTTAACGAAAGCGAGGGAGATTTTTTGA
AA sequence
>Lus10003703 pacid=23179467 polypeptide=Lus10003703 locus=Lus10003703.g ID=Lus10003703.BGIv1.0 annot-version=v1.0
MRIHSQFSKLYSSRRAFFIRGYSISTIPSVYEQSDSVKTISKIMMSTPAVTLDTALDQSGVRISTEVVESVLKRFENAGMLAFQFFEWADNHRHYDHSIR
AYHTMIESLSKIRQYRLMWDLVNSMKSKRMLNVETFCIIMRKYARAKKVEEAVYAFNVMEKYDVPQNLAAFNGLLSALCKSQNVRKAQELFDGMKDKFVP
DSKTYSILLEGWGRAPDLTKAREIF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G77360 Tetratricopeptide repeat (TPR)... Lus10003703 0 1
AT3G11900 ANT1 aromatic and neutral transport... Lus10017224 52.5 0.6711
AT4G28010 Tetratricopeptide repeat (TPR)... Lus10033641 56.1 0.6712
AT2G20830 transferases;folic acid bindin... Lus10018557 61.8 0.6707
AT3G18310 unknown protein Lus10027301 92.3 0.6106
AT1G03190 ATXPD, UVH6 ULTRAVIOLET HYPERSENSITIVE 6, ... Lus10000652 118.2 0.6410
AT1G31814 FRL2 FRIGIDA like 2 (.1) Lus10042965 245.5 0.5855
Lus10026028 254.0 0.5998

Lus10003703 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.