Lus10003726 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26594 49 / 3e-08 ARR24 response regulator 24 (.1)
AT3G04280 38 / 0.0003 ARR22 response regulator 22 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005407 56 / 9e-11 AT5G26594 135 / 2e-41 response regulator 24 (.1)
Lus10004775 43 / 2e-06 AT5G26594 98 / 2e-27 response regulator 24 (.1)
Lus10028021 0 / 1 AT5G26594 99 / 3e-27 response regulator 24 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G108000 54 / 2e-10 AT5G26594 163 / 5e-53 response regulator 24 (.1)
Potri.002G253000 43 / 3e-06 AT5G26594 171 / 5e-56 response regulator 24 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0304 CheY PF00072 Response_reg Response regulator receiver domain
Representative CDS sequence
>Lus10003726 pacid=23169652 polypeptide=Lus10003726 locus=Lus10003726.g ID=Lus10003726.BGIv1.0 annot-version=v1.0
ATGGGATCTGAAGATAGCAACAAGTACAGTATGATCAAAGCTCTAGTGGTGGACGACGAACCGGTAGCGAAGCTCCACCACGCCAAATATCTTGCGAAAG
TCGGCATTCTGAACCACAAGGTTGTCAGCAACGGCGAGGAAGCAGTCGACTTGGTCACTTCGTTGGGTGCCGAGTATTTCGATGTCGTTCTCATGGATAT
CGACAACAAAGAAGCTGCGCGACATGGGGGTACGAAACATGATCGTGGGGGTATCGTCGCGTTCACGAACTGGTGCACTGATCATAGCAACTATGGAGAG
TGGAATTATGGATGA
AA sequence
>Lus10003726 pacid=23169652 polypeptide=Lus10003726 locus=Lus10003726.g ID=Lus10003726.BGIv1.0 annot-version=v1.0
MGSEDSNKYSMIKALVVDDEPVAKLHHAKYLAKVGILNHKVVSNGEEAVDLVTSLGAEYFDVVLMDIDNKEAARHGGTKHDRGGIVAFTNWCTDHSNYGE
WNYG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26594 ARR24 response regulator 24 (.1) Lus10003726 0 1

Lus10003726 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.