Lus10003733 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52420 53 / 7e-11 ATOEP7 outer envelope membrane protein 7 (.1)
AT5G19151 42 / 9e-07 unknown protein
AT3G63160 35 / 0.0005 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034040 42 / 2e-06 AT5G19151 58 / 9e-13 unknown protein
Lus10023307 37 / 0.0001 AT2G34585 76 / 5e-20 unknown protein
Lus10038503 36 / 0.0004 AT2G34585 78 / 9e-21 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208100 67 / 3e-16 AT3G52420 52 / 2e-10 outer envelope membrane protein 7 (.1)
Potri.002G054700 60 / 1e-13 AT3G52420 49 / 1e-09 outer envelope membrane protein 7 (.1)
Potri.017G127350 47 / 2e-08 AT3G52420 53 / 4e-11 outer envelope membrane protein 7 (.1)
Potri.008G203800 40 / 5e-06 AT5G19151 54 / 2e-11 unknown protein
Potri.011G084300 35 / 0.0006 AT2G34585 77 / 9e-21 unknown protein
PFAM info
Representative CDS sequence
>Lus10003733 pacid=23169653 polypeptide=Lus10003733 locus=Lus10003733.g ID=Lus10003733.BGIv1.0 annot-version=v1.0
ATGAAGCCGGTGAAACAAGCAGCGGTGGTGCTGGGAGCTCTGGCGTTCGGATGGCTGGCGATTGAGATTGCTTTCAAGCCTTTCCTCGACAACGCTCGTT
CCTCCATGGCCAAGTCCGACCCCGATCACGATCCTGACGATGAGGGCGATAAGCCTGACTCCTCCTCCTCCGCTGCTGTTGACGCGGCTCTTGATGCTGT
TGCTGATGCCGCTGCCTCTGTAGCCGCTCCGGAAACTTCCGCCGAGTAA
AA sequence
>Lus10003733 pacid=23169653 polypeptide=Lus10003733 locus=Lus10003733.g ID=Lus10003733.BGIv1.0 annot-version=v1.0
MKPVKQAAVVLGALAFGWLAIEIAFKPFLDNARSSMAKSDPDHDPDDEGDKPDSSSSAAVDAALDAVADAAASVAAPETSAE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52420 ATOEP7 outer envelope membrane protei... Lus10003733 0 1
AT4G38620 MYB AtMYB4 myb domain protein 4 (.1) Lus10041888 1.4 0.8996
AT1G27180 disease resistance protein (TI... Lus10000423 2.0 0.8868
AT2G28305 ATLOG1 LONELY GUY 1, Putative lysine ... Lus10016096 2.8 0.8906
AT4G21510 F-box family protein (.1) Lus10022370 3.2 0.8862
AT5G18100 CSD3 copper/zinc superoxide dismuta... Lus10013615 3.5 0.8889
AT1G59950 NAD(P)-linked oxidoreductase s... Lus10039266 6.5 0.8839
AT5G10250 DOT3 DEFECTIVELY ORGANIZED TRIBUTAR... Lus10026046 7.0 0.8829
AT5G10530 Concanavalin A-like lectin pro... Lus10033778 8.1 0.8403
AT4G37340 CYP81D3 "cytochrome P450, family 81, s... Lus10024973 9.5 0.8338
AT1G30690 Sec14p-like phosphatidylinosit... Lus10031176 10.0 0.8681

Lus10003733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.