Lus10003735 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028026 202 / 3e-68 AT4G23290 44 / 1e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 128 / 8e-39 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10003735 pacid=23169636 polypeptide=Lus10003735 locus=Lus10003735.g ID=Lus10003735.BGIv1.0 annot-version=v1.0
ATGAACAATCTCCTCTCCAAATCATCAACCTTACCCTTAGTCCTCCTCATCCTCCTCCTCACCATCTTCGCCGGCGGCGTGCCGAACACCAACGTCACCT
CACTCCTCTGCAACGCCAACATCTACACCTCCGGCGACCCTTTCGCCATAAGCCTGGCCTACGTCGTAGGGGACATCGAGGCAAACGCTCCGGCTCGCGA
CAAGTACGACTACTACAACATCTCCCCCTTCCCCAACGCCTTCGCCTACGGCCACGGCGTGTGTAATGTCAACATCAGCCGCGTTGACTGTGCCGCCTGC
CTTGTGGCTGCGAAGGCCGCGCTGATCGCTGGCTGTCCAGACCGGATTGGGGGCCGGTCGGGGCTGGTTGATTGTTTGATTAGGTATGAACAGCGTCCTT
TCGTTGATGATCAATAG
AA sequence
>Lus10003735 pacid=23169636 polypeptide=Lus10003735 locus=Lus10003735.g ID=Lus10003735.BGIv1.0 annot-version=v1.0
MNNLLSKSSTLPLVLLILLLTIFAGGVPNTNVTSLLCNANIYTSGDPFAISLAYVVGDIEANAPARDKYDYYNISPFPNAFAYGHGVCNVNISRVDCAAC
LVAAKAALIAGCPDRIGGRSGLVDCLIRYEQRPFVDDQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G23210 HIG1, CRK13 cysteine-rich RLK (RECEPTOR-li... Lus10003735 0 1
AT3G10120 unknown protein Lus10021358 13.9 0.7103
AT3G11600 unknown protein Lus10043404 14.1 0.7297
AT4G37120 SMP2 SWELLMAP 2, Pre-mRNA splicing ... Lus10007480 17.7 0.6301
AT5G57550 XTR3, XTH25, EX... xyloglucan endotransglycosylas... Lus10012834 18.0 0.6277
AT3G24535 unknown protein Lus10023639 25.2 0.6961
AT5G20270 HHP1 heptahelical transmembrane pro... Lus10008057 90.6 0.5566
AT4G11280 ATACS6, ACS6 1-aminocyclopropane-1-carboxyl... Lus10028761 103.3 0.5994
AT2G24370 Protein kinase protein with ad... Lus10024212 174.6 0.5312
AT4G33550 Bifunctional inhibitor/lipid-t... Lus10005010 205.6 0.5510

Lus10003735 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.