Lus10003739 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G08280 136 / 1e-42 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028031 218 / 9e-75 AT4G08280 163 / 6e-53 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G085200 144 / 2e-45 AT4G08280 151 / 2e-48 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF05768 DUF836 Glutaredoxin-like domain (DUF836)
Representative CDS sequence
>Lus10003739 pacid=23169628 polypeptide=Lus10003739 locus=Lus10003739.g ID=Lus10003739.BGIv1.0 annot-version=v1.0
ATGATGATGAACTTGACGGCCGCGGCGATATCGGCGACGAGGCCATCTTCCCTGACAATCCTCAACAGACGCACAGCCAGACCCCTCTTCACACCTGTGG
CGTCCCTATCCTCTTCTTCTCCGACCAGAAAACTAGTGCTCTACTCAAAGCCCGGATGCTGTTTGTGCGATGGCCTCAAAGAGAAGCTTCAAGCCGCGTT
CTCCCTCTCCGGCCCTTCTCCCCTCCACGACGTCGATCTCCAGGTCAGGGATATCACCACTAATCCGGATTGGGAGAAAGCTTACCAGTACGAGATTCCT
GTCCTAGCCAAACTCCATTCTGATGGCACCGAAGGAGCTCTTTCTTTGTTACTACCCGAATCACATAGGCAGAGAGCCCTTTCTAGCCCTTTCTAG
AA sequence
>Lus10003739 pacid=23169628 polypeptide=Lus10003739 locus=Lus10003739.g ID=Lus10003739.BGIv1.0 annot-version=v1.0
MMMNLTAAAISATRPSSLTILNRRTARPLFTPVASLSSSSPTRKLVLYSKPGCCLCDGLKEKLQAAFSLSGPSPLHDVDLQVRDITTNPDWEKAYQYEIP
VLAKLHSDGTEGALSLLLPESHRQRALSSPF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G08280 Thioredoxin superfamily protei... Lus10003739 0 1
AT5G13470 unknown protein Lus10005318 1.4 0.7814
AT3G10610 Ribosomal S17 family protein (... Lus10016985 13.2 0.8350
AT5G60030 unknown protein Lus10023334 24.4 0.7627
AT5G42520 BBR_BPC BPC6, BBR/BPC6,... ARABIDOPSIS THALIANA BASIC PEN... Lus10024313 47.0 0.6913
AT5G40380 CRK42 cysteine-rich RLK (RECEPTOR-li... Lus10008764 60.5 0.6588
AT5G42520 BBR_BPC BPC6, BBR/BPC6,... ARABIDOPSIS THALIANA BASIC PEN... Lus10012389 67.7 0.6509
AT5G17510 unknown protein Lus10024530 74.1 0.7038
AT5G39600 unknown protein Lus10033166 82.0 0.6999
AT3G47620 TCP AtTCP14, TCP14 "TEOSINTE BRANCHED, cycloidea ... Lus10041328 99.5 0.7101
AT1G71850 Ubiquitin carboxyl-terminal hy... Lus10005750 135.1 0.6767

Lus10003739 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.