Lus10003752 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G01660 41 / 0.0001 PDLP6 plasmodesmata-located protein 6 (.1.2)
AT1G70690 40 / 0.0002 HWI1, PDLP5 PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028046 243 / 4e-84 AT1G70690 41 / 1e-04 PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1)
Lus10008314 108 / 4e-31 ND /
Lus10035753 110 / 8e-31 ND /
Lus10008311 105 / 1e-29 ND 35 / 0.008
Lus10010116 100 / 1e-27 ND 36 / 0.007
Lus10028053 105 / 2e-27 AT3G11080 120 / 8e-29 receptor like protein 35 (.1)
Lus10012621 100 / 2e-27 ND 38 / 0.002
Lus10028050 99 / 5e-27 ND 36 / 0.004
Lus10029618 98 / 8e-27 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G133500 40 / 0.0002 AT2G01660 332 / 1e-114 plasmodesmata-located protein 6 (.1.2)
Potri.010G108100 39 / 0.0005 AT2G01660 265 / 2e-88 plasmodesmata-located protein 6 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10003752 pacid=23169655 polypeptide=Lus10003752 locus=Lus10003752.g ID=Lus10003752.BGIv1.0 annot-version=v1.0
ATGGAGCACTGCAACTCAAAATCAACAACAGCAGCAATCCTTATCCTCCTCGGAGTACTAGCAGTACTAGTCAACTGCAAAGTGGGTCCGGACATCAGCA
TCGTGAGAGGGCCCACATGCACCGGAATATCGAAGAACAACGGCTACACCAAGAGTGTGGCGACTCTCCTCGGGACCCTAGTCAACGAAACCAAAAACGT
GCACAGGGAGACGGTCCACCAAGTTTACAGGTACTCCCGCCAGATCCCGGACTCCGAACCAGGGTCGGTGACCGGGACCGCGGTTTGTTCGGGTGAGTTG
GGTAAATCGGAATGCTGGGAGTGTTTGGTCCATGCACAAGGGAAGCTGACTACGGGATGTGTTGATCCGGTTAAGGGCAGTGTCAAGTTGCAGGATTGTT
CCATTTGGTTCGACAAAAAGTGTTGA
AA sequence
>Lus10003752 pacid=23169655 polypeptide=Lus10003752 locus=Lus10003752.g ID=Lus10003752.BGIv1.0 annot-version=v1.0
MEHCNSKSTTAAILILLGVLAVLVNCKVGPDISIVRGPTCTGISKNNGYTKSVATLLGTLVNETKNVHRETVHQVYRYSRQIPDSEPGSVTGTAVCSGEL
GKSECWECLVHAQGKLTTGCVDPVKGSVKLQDCSIWFDKKC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G70690 HWI1, PDLP5 PLASMODESMATA-LOCATED PROTEIN ... Lus10003752 0 1
AT1G59610 DRP2B, CF1, ADL... Dynamin related protein 2B, dy... Lus10024462 2.6 0.8730
Lus10021760 6.0 0.7526
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10000682 6.6 0.7802
Lus10003753 8.1 0.7802
AT1G63690 ATSPPL2 SIGNAL PEPTIDE PEPTIDASE-LIKE ... Lus10035485 8.9 0.7243
AT3G52970 CYP76G1 "cytochrome P450, family 76, s... Lus10032339 9.4 0.7802
AT4G20040 Pectin lyase-like superfamily ... Lus10008700 10.5 0.7802
AT4G30720 PDE327 PIGMENT DEFECTIVE 327, FAD/NAD... Lus10010776 15.2 0.7226
AT3G27470 Protein of unknown function (D... Lus10035228 17.7 0.7426
AT2G37370 unknown protein Lus10009063 24.6 0.7238

Lus10003752 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.