Lus10003753 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003755 178 / 1e-58 ND 37 / 0.002
Lus10003754 173 / 7e-57 AT1G04520 39 / 3e-04 plasmodesmata-located protein 2 (.1)
Lus10008314 139 / 3e-43 ND /
Lus10029617 138 / 6e-43 ND /
Lus10032770 132 / 1e-40 ND /
Lus10029619 130 / 7e-40 ND /
Lus10032788 130 / 1e-39 ND 36 / 0.007
Lus10042684 129 / 1e-39 ND /
Lus10035753 130 / 5e-39 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 39 / 0.0002 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10003753 pacid=23169643 polypeptide=Lus10003753 locus=Lus10003753.g ID=Lus10003753.BGIv1.0 annot-version=v1.0
ATGGCGGTAGCCACGATCGTGCTCATCTCTATTCTAAGCATGGTTCACGGCCAAGACACGAGACTCATCAACGGACCCCAGTGCGCGAAGAAATGCGACG
ACAAGGTGTACAACGACAACGTTGCGCGTCTCCTAGGCCACTTTGTTCACGAGACCAAGAACGTGAAGAGGAAGAAACACGAGAATTACGCGTACTATCA
CAACTTCCCCAACAAGGATCTCGGATCGGTCACTGGAGGGGTCATCTGTGACGGACACCTTTGGGGATGGCAATGCGAGAGCTGTCTTAAGACGGCGAGG
AAGAAGATCTACAGAGGGTGTGGATCAACGACTGAAGCTAGCATCGAACTCCAAGATTGCTCGATGTGGTTCGCGAAGATCGAACGTAAAGTTGAATAG
AA sequence
>Lus10003753 pacid=23169643 polypeptide=Lus10003753 locus=Lus10003753.g ID=Lus10003753.BGIv1.0 annot-version=v1.0
MAVATIVLISILSMVHGQDTRLINGPQCAKKCDDKVYNDNVARLLGHFVHETKNVKRKKHENYAYYHNFPNKDLGSVTGGVICDGHLWGWQCESCLKTAR
KKIYRGCGSTTEASIELQDCSMWFAKIERKVE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003753 0 1
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10000682 1.0 1.0000
AT3G52970 CYP76G1 "cytochrome P450, family 76, s... Lus10032339 1.4 1.0000
AT3G27470 Protein of unknown function (D... Lus10035228 2.0 0.9631
AT1G59610 DRP2B, CF1, ADL... Dynamin related protein 2B, dy... Lus10024462 2.2 0.9363
AT4G20040 Pectin lyase-like superfamily ... Lus10008700 2.4 1.0000
AT4G30720 PDE327 PIGMENT DEFECTIVE 327, FAD/NAD... Lus10010776 4.6 0.9312
AT2G37370 unknown protein Lus10009063 5.5 0.9356
Lus10021760 6.3 0.7867
AT1G63690 ATSPPL2 SIGNAL PEPTIDE PEPTIDASE-LIKE ... Lus10035485 7.5 0.7896
AT1G70690 HWI1, PDLP5 PLASMODESMATA-LOCATED PROTEIN ... Lus10003752 8.1 0.7802

Lus10003753 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.