Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70690 39 / 0.0003 HWI1, PDLP5 PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1) AT1G04520 39 / 0.0004 PDLP2 plasmodesmata-located protein 2 (.1) AT3G04370 39 / 0.0005 PDLP4 plasmodesmata-located protein 4 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003755 [exp] 252 / 4e-88 ND 37 / 0.002 Lus10003753 [exp] 173 / 9e-57 ND / Lus10029619 [exp] 129 / 1e-39 ND / Lus10032770 [exp] 128 / 6e-39 ND / Lus10042684 [exp] 127 / 8e-39 ND / Lus10008314 [exp] 127 / 1e-38 ND / Lus10029617 [exp] 127 / 2e-38 ND / Lus10029618 [exp] 125 / 1e-37 ND / Lus10035753 [exp] 125 / 5e-37 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G023876 [exp] 45 / 4e-06 AT4G23180 489 / 5e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024140 [exp] 42 / 3e-05 AT4G23180 497 / 3e-168 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.010G108100 [exp] 39 / 0.0005 AT2G01660 265 / 2e-88 plasmodesmata-located protein 6 (.1.2) Potri.005G208400 [exp] 38 / 0.0006 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1) Potri.013G048200 [exp] 38 / 0.0007 AT1G04520 214 / 3e-68 plasmodesmata-located protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [flax] [poplar] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Lus10003754 pacid=23169632 polypeptide=Lus10003754 locus=Lus10003754.g ID=Lus10003754.BGIv1.0 annot-version=v1.0 ATGACGGTAGCCACGGTCATCATGCTCATCTCTATTCTGAGTGTGGTTCACTGTCAAGACACGAGACTCATCAGCGGACCTCATTGTAAGACAAGTTCCA ACGATAAGTCATACAATGACAACGCTGGCAAGCTCCTCCATCTCCTCGTCAACGATACCAAGAAGGTGAGGAGGTCAGGGCACCAGGACTTTTCTTACAA TCACAACTTCCCCAACAAGGATGTCGGATCTGTCACCGGAGGCGCTAAATGCAATGGACACCTTTGGGGATGGCAATGTGAGAGTTGTCTTCGCTCGGCA AGGAAGAAAATCCAGAAAGGGTGTAAGCCCTCCATTGAAGGTAGCGTCTACTTGGAAGATTGCTCCATATGGTACAAGAAGATCGTTTGA
AA sequence Show only first row Show all	>Lus10003754 pacid=23169632 polypeptide=Lus10003754 locus=Lus10003754.g ID=Lus10003754.BGIv1.0 annot-version=v1.0 MTVATVIMLISILSVVHCQDTRLISGPHCKTSSNDKSYNDNAGKLLHLLVNDTKKVRRSGHQDFSYNHNFPNKDVGSVTGGAKCNGHLWGWQCESCLRSA RKKIQKGCKPSIEGSVYLEDCSIWYKKIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G04520		PDLP2	plasmodesmata-located protein ...		Lus10003754 [exp]	0	1
AT1G11920			Pectin lyase-like superfamily ...		Lus10018430 [exp]	3.5	0.8072
AT5G05390		LAC12	laccase 12 (.1)		Lus10009841 [exp]	4.9	0.8456
AT1G52540			Protein kinase superfamily pro...		Lus10001323 [exp]	8.9	0.7679
AT3G48180			unknown protein		Lus10030823 [exp]	10.5	0.7507
AT5G49350			Glycine-rich protein family (....		Lus10041125 [exp]	10.7	0.8050
AT5G44550			Uncharacterised protein family...		Lus10000781 [exp]	10.8	0.8486
					Lus10030066 [exp]	16.2	0.6961
AT4G31115			Protein of unknown function (D...		Lus10018151 [exp]	16.2	0.7432
					Lus10032002 [exp]	16.7	0.7370
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Lus10018711 [exp]	18.5	0.7681

Compare expression of checked genes

Lus10003754 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.