Lus10003755 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003754 252 / 4e-88 AT1G04520 39 / 3e-04 plasmodesmata-located protein 2 (.1)
Lus10003753 177 / 1e-58 ND /
Lus10032770 140 / 9e-44 ND /
Lus10029617 140 / 1e-43 ND /
Lus10029619 137 / 1e-42 ND /
Lus10042684 134 / 3e-41 ND /
Lus10029618 133 / 7e-41 ND /
Lus10008314 133 / 1e-40 ND /
Lus10032788 131 / 7e-40 ND 36 / 0.007
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G023876 42 / 5e-05 AT4G23180 489 / 5e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G024140 41 / 0.0001 AT4G23180 497 / 3e-168 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10003755 pacid=23169651 polypeptide=Lus10003755 locus=Lus10003755.g ID=Lus10003755.BGIv1.0 annot-version=v1.0
ATGGTGAGTTTCGTGTCGAAAATGACTGTAGCCACGGTCATCATGCTCATCTCTATTCTAAGCGTGGTTCACTGCCAAGACACGAGACTCATCAGCGGAC
CTCATTGTCAGAAAAGTTCCAATGATGAATCATACAACAACAACGTCGGTAAGCTCCTCCATCTCCTTGTCAACGATACCAAGAAGGTGAGGAGGTCGGG
ACACCAGGAATTTTCTTACAATCACAACTATCCCAACAAGGATGTCGGATCGGTCACCGGAGGCGCTATATGCGACGGACACCTTTGGGGATGGCAATGC
GAGAGTTGTCTTCGCTCGGCAAGGAAGAAAATCCAAAAAGGGTGTAAGCCCTCCATTGAAGGTAGCGTTTACTTGGAAGATTGCTCCATATGGTTCAAGA
AAATCGTTGTTTGA
AA sequence
>Lus10003755 pacid=23169651 polypeptide=Lus10003755 locus=Lus10003755.g ID=Lus10003755.BGIv1.0 annot-version=v1.0
MVSFVSKMTVATVIMLISILSVVHCQDTRLISGPHCQKSSNDESYNNNVGKLLHLLVNDTKKVRRSGHQEFSYNHNYPNKDVGSVTGGAICDGHLWGWQC
ESCLRSARKKIQKGCKPSIEGSVYLEDCSIWFKKIVV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003755 0 1
AT2G38150 alpha 1,4-glycosyltransferase ... Lus10027771 1.0 0.9949
AT5G15740 RRT1 O-fucosyltransferase family pr... Lus10036832 2.8 0.9947
AT1G77410 BGAL16 beta-galactosidase 16 (.1) Lus10033427 3.0 0.9916
AT2G38150 alpha 1,4-glycosyltransferase ... Lus10035525 3.5 0.9908
AT5G15740 RRT1 O-fucosyltransferase family pr... Lus10019195 4.5 0.9899
AT1G01180 S-adenosyl-L-methionine-depend... Lus10013195 4.9 0.9891
Lus10038295 5.3 0.9884
AT2G38150 alpha 1,4-glycosyltransferase ... Lus10027772 6.9 0.9827
AT5G64330 JK218, RPT3, NP... ROOT PHOTOTROPISM 3, NON-PHOTO... Lus10015190 9.5 0.9434
Lus10002317 9.9 0.9619

Lus10003755 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.