Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05200 38 / 0.001 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010118 [exp] 196 / 4e-66 AT1G04520 40 / 3e-04 plasmodesmata-located protein 2 (.1) Lus10010115 [exp] 178 / 2e-59 AT5G48540 41 / 5e-05 receptor-like protein kinase-related family protein (.1) Lus10028049 [exp] 176 / 7e-58 AT1G04520 38 / 9e-04 plasmodesmata-located protein 2 (.1) Lus10012623 [exp] 176 / 8e-58 ND 38 / 0.001 Lus10003758 [exp] 163 / 1e-51 ND / Lus10028050 [exp] 107 / 9e-31 ND 36 / 0.004 Lus10008314 [exp] 105 / 3e-30 ND / Lus10035753 [exp] 103 / 1e-28 ND / Lus10008311 [exp] 100 / 4e-28 ND 35 / 0.008
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G208400 [exp] 44 / 2e-06 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1) Potri.008G171700 [exp] 39 / 0.0003 AT1G04520 349 / 3e-121 plasmodesmata-located protein 2 (.1) Potri.002G257300 [exp] 39 / 0.0005 AT1G04520 243 / 2e-79 plasmodesmata-located protein 2 (.1) Potri.011G028100 [exp] 39 / 0.0006 AT4G05200 519 / 8e-177 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G023788 [exp] 38 / 0.0007 AT4G23180 559 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024228 [exp] 38 / 0.0008 AT4G23180 551 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.010G065800 [exp] 38 / 0.0008 AT1G04520 337 / 2e-116 plasmodesmata-located protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [flax] [poplar] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Lus10003759 pacid=23169641 polypeptide=Lus10003759 locus=Lus10003759.g ID=Lus10003759.BGIv1.0 annot-version=v1.0 ATGGGTCTAAGCATCATGCTCCTCGTCGTAGATGCCAAACTTCCCAACACCAAGGTCATGGTCAAGCCCAGTTGTGCAGGTGTCGGAACTGCGAGCAAGG GATTCACCAAGTACGTGGCGCACTTGCTGGATTTCTTGGTGGACGAGACGAAGAACGTGTACAGGAACAAGGATGACGGGAGTTACACTTACAGTCATAA CTACCCTGATCCAGAATCGAGGTCTGCCAACGGGGTGGGGAGTTGTGGTGGGGAGCTTGAGAAGTTGGATTGTTGGTCGTGTCTCCGAATTGCGAAGGAC AAGGTGAATTCGGCTTGCCACAAGGCAGTAGGCGGTAACGTCACTCTCAAGGACTGCTCCATCTCCTTCAAAATGATTCCTTAA
AA sequence Show only first row Show all	>Lus10003759 pacid=23169641 polypeptide=Lus10003759 locus=Lus10003759.g ID=Lus10003759.BGIv1.0 annot-version=v1.0 MGLSIMLLVVDAKLPNTKVMVKPSCAGVGTASKGFTKYVAHLLDFLVDETKNVYRNKDDGSYTYSHNYPDPESRSANGVGSCGGELEKLDCWSCLRIAKD KVNSACHKAVGGNVTLKDCSISFKMIP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10003759 [exp]	0	1
AT3G51560			Disease resistance protein (TI...		Lus10009109 [exp]	8.9	0.7145
					Lus10041324 [exp]	15.9	0.6582
AT3G03530		NPC4	non-specific phospholipase C4 ...		Lus10028492 [exp]	18.3	0.6691
AT1G49570			Peroxidase superfamily protein...		Lus10023858 [exp]	20.8	0.6895
AT5G04350			Plant self-incompatibility pro...		Lus10029381 [exp]	32.2	0.6107
AT3G07610		IBM1	increase in bonsai methylation...		Lus10004549 [exp]	35.4	0.6579
AT3G63410		VTE3, APG1, IEP...	VITAMIN E DEFECTIVE 3, INNER E...		Lus10014711 [exp]	41.8	0.6276
AT1G14040			EXS (ERD1/XPR1/SYG1) family pr...		Lus10026623 [exp]	85.6	0.6092
AT1G03050			ENTH/ANTH/VHS superfamily prot...		Lus10000201 [exp]	100.4	0.5578
					Lus10021285 [exp]	123.3	0.5289

Compare expression of checked genes

Lus10003759 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.