Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G04865 52 / 5e-09 Aminotransferase-like, plant mobile domain family protein (.1) AT1G48120 48 / 1e-07 hydrolases;protein serine/threonine phosphatases (.1) AT2G25010 47 / 2e-07 Aminotransferase-like, plant mobile domain family protein (.1) AT1G17930 45 / 2e-06 Aminotransferase-like, plant mobile domain family protein (.1) AT1G50790 39 / 0.0003 Plant mobile domain protein family (.1) AT1G51538 37 / 0.0006 Aminotransferase-like, plant mobile domain family protein (.1) AT1G50760 36 / 0.0006 Aminotransferase-like, plant mobile domain family protein (.1) AT1G50770 37 / 0.001 Aminotransferase-like, plant mobile domain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027047 [exp] 67 / 3e-14 AT1G17930 119 / 1e-28 Aminotransferase-like, plant mobile domain family protein (.1) Lus10020970 [exp] 65 / 1e-13 AT1G17930 123 / 2e-30 Aminotransferase-like, plant mobile domain family protein (.1) Lus10032693 [exp] 61 / 2e-13 AT2G25010 52 / 3e-09 Aminotransferase-like, plant mobile domain family protein (.1) Lus10008761 [exp] 64 / 3e-13 AT2G25010 79 / 1e-15 Aminotransferase-like, plant mobile domain family protein (.1) Lus10003430 [exp] 60 / 8e-12 AT5G51100 60 / 6e-10 Fe superoxide dismutase 2 (.1) Lus10012081 [exp] 57 / 7e-11 AT1G17930 53 / 8e-08 Aminotransferase-like, plant mobile domain family protein (.1) Lus10042711 [exp] 53 / 3e-10 AT2G25010 50 / 4e-08 Aminotransferase-like, plant mobile domain family protein (.1) Lus10004818 [exp] 55 / 6e-10 AT1G17930 56 / 2e-08 Aminotransferase-like, plant mobile domain family protein (.1) Lus10001737 [exp] 52 / 7e-09 AT2G04865 636 / 0.0 Aminotransferase-like, plant mobile domain family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10003764 pacid=23180846 polypeptide=Lus10003764 locus=Lus10003764.g ID=Lus10003764.BGIv1.0 annot-version=v1.0 ATGCAGGCTCCACCTTGGGAAGGCTATGGTCCGATGAGGCTCGATATTTCATTGAGGCCTCTGGGTTGTCGAATCTCGGACGGGTTATGTCATAGGGGAT TGGATCTTCCCCTAATGTTGGCGTTCGTTGAGAGGTGGCAGTCAGACACCAACACCTTTCACATGTCATTTGGAGAGATGACGATTACGTTGCACATTGT GGTGTACTTACTTAGGATTCTCATACGGGGCACCCAGCTTAGTTCAGAGGGGGCGAGAAGAATTATGTGGTGCAGCTTGCCTCCATGCTGTGTCTGGTGA
AA sequence Show only first row Show all	>Lus10003764 pacid=23180846 polypeptide=Lus10003764 locus=Lus10003764.g ID=Lus10003764.BGIv1.0 annot-version=v1.0 MQAPPWEGYGPMRLDISLRPLGCRISDGLCHRGLDLPLMLAFVERWQSDTNTFHMSFGEMTITLHIVVYLLRILIRGTQLSSEGARRIMWCSLPPCCVW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G25010			Aminotransferase-like, plant m...		Lus10003764 [exp]	0	1
AT5G40250			RING/U-box superfamily protein...		Lus10008797 [exp]	1.0	1.0000
AT4G34135		UGT73B2	UDP-glucosyltransferase 73B2 (...		Lus10010240 [exp]	1.4	0.8303
AT1G65440		GTB1	global transcription factor gr...		Lus10034231 [exp]	3.5	0.7679
					Lus10034034 [exp]	6.6	0.6546
AT5G02700			F-box/RNI-like superfamily pro...		Lus10037151 [exp]	7.3	0.6248
					Lus10012676 [exp]	10.4	0.8260
AT4G20820			FAD-binding Berberine family p...		Lus10023376 [exp]	15.7	0.7666
					Lus10022805 [exp]	18.7	0.7346
AT5G05530			RING/U-box superfamily protein...		Lus10024629 [exp]	20.1	0.7346
AT1G10380			Putative membrane lipoprotein ...		Lus10036702 [exp]	20.5	0.5286

Compare expression of checked genes

Lus10003764 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.