Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55080 111 / 9e-32 MED9 unknown protein AT1G29580 52 / 4e-10 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G037200 [exp] 138 / 5e-43 AT1G55080 150 / 1e-45 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003788 pacid=23162678 polypeptide=Lus10003788 locus=Lus10003788.g ID=Lus10003788.BGIv1.0 annot-version=v1.0 ATGAGTTTCCTTTTCTTGCAGTGGGTAGATAAACTAGCTGATGCTATTGAGAATGGGACTCGAGATCAACACTCTGATGTCCTGGTTAATGATTTGAACA ATCAGTTTGACAAGTGCCAGCAGCTATTAAACTCTATCTCCAGCTCAATCACCTCCAAGTCTATGACTGTTGAAGGACAGAAGAAAAAGTTGGAAGAAAC TGAGCAATTGCTAAATCAAAGAAGAGACTTGATCGGTAAATACAAAAATTCTGTTGAAGAACTTGTCAAGTCTGAGCCATGA
AA sequence Show only first row Show all	>Lus10003788 pacid=23162678 polypeptide=Lus10003788 locus=Lus10003788.g ID=Lus10003788.BGIv1.0 annot-version=v1.0 MSFLFLQWVDKLADAIENGTRDQHSDVLVNDLNNQFDKCQQLLNSISSSITSKSMTVEGQKKKLEETEQLLNQRRDLIGKYKNSVEELVKSEP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G55080		MED9	unknown protein		Lus10003788 [exp]	0	1
AT5G25080			Sas10/Utp3/C1D family (.1)		Lus10003434 [exp]	10.7	0.6727
AT2G24990			Serine/threonine-protein kinas...		Lus10032627 [exp]	15.3	0.7098
AT3G11980		FAR2, MS2	MALE STERILITY 2, FATTY ACID R...		Lus10029336 [exp]	17.1	0.7005
AT1G01770			unknown protein		Lus10036349 [exp]	17.9	0.7084
AT1G09730			Cysteine proteinases superfami...		Lus10000917 [exp]	23.1	0.7071
AT3G52120			SWAP (Suppressor-of-White-APri...		Lus10015703 [exp]	24.4	0.6993
AT3G25840			Protein kinase superfamily pro...		Lus10021688 [exp]	27.0	0.6813
AT2G13680		GLS2, ATGSL02, ...	ARABIDOPSIS THALIANA GLUCAN SY...		Lus10000830 [exp]	30.6	0.6903
AT3G54860		ATVPS33	VACUOLAR PROTEIN SORTING 33, S...		Lus10007300 [exp]	33.2	0.6785
AT4G03090			sequence-specific DNA binding;...		Lus10024746 [exp]	39.2	0.6867

Compare expression of checked genes

Lus10003788 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.