Lus10003801 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22142 92 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G15160 84 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT3G22120 84 / 3e-18 CWLP cell wall-plasma membrane linker protein (.1)
AT1G62500 79 / 7e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G10940 74 / 7e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT4G12470 60 / 7e-11 AZI1 azelaic acid induced 1 (.1)
AT4G12480 57 / 7e-10 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12500 57 / 1e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12490 56 / 3e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G45180 51 / 5e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010479 112 / 2e-29 AT3G22142 168 / 3e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10010482 107 / 4e-29 AT3G22142 162 / 5e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10003802 81 / 2e-17 ND 127 / 5e-33
Lus10010480 78 / 4e-17 ND 127 / 3e-34
Lus10032262 79 / 6e-17 AT1G62500 162 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10028930 76 / 5e-16 AT1G62500 141 / 4e-41 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10004349 69 / 2e-13 AT1G62500 134 / 5e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10027704 65 / 2e-12 AT2G10940 135 / 2e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10001493 59 / 7e-11 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G008300 97 / 6e-24 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G008500 95 / 1e-23 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
Potri.016G015500 90 / 4e-20 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G065500 74 / 9e-16 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.003G111300 74 / 3e-15 AT1G62500 125 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.018G126000 72 / 2e-14 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.018G025900 56 / 1e-09 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.008G135860 56 / 4e-09 AT1G62500 75 / 7e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G121900 52 / 4e-08 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G158400 51 / 5e-08 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10003801 pacid=23145959 polypeptide=Lus10003801 locus=Lus10003801.g ID=Lus10003801.BGIv1.0 annot-version=v1.0
ATGGCCAAGCAATACTACTCTCTAGCTAGCTTCTTGCTATTCTTGGTTCTCAACTTGGGAGCCTTGATTGTTCCTTCTCTTGCTTGCCCTTCATGCACTC
TTCCTCCTCCTCCTTGCCCACCAACTAAGCCACCACATATCAAGCCAACACCACCCACCGTGAAGCCAACACCGCCTGTGACGCCACCTGTGAAGCCGAC
ACCACCAACTGTCAAGCCAACGCCACCTGTGAAGCCGACACCACCAACTGTCAAGCCAACGCCACCTGTGAAGCCGACACCACCAACTGTCAAGCCAACG
CCACCTGTGAAGCCGACACCACCAACTGTCAAGCCAACGCCACCTACTGTCAAACCAACACCACCCGTGAAGCCAACACCACCTACTGTCAAACCAACGC
CACCCGTGAAGCCAACACCACCTACTGTCAAGCCAACACCGCCCGTGAAGCCAACACCCCCAACTGTCAAGCCAACGCCACCCACTGTCAAGCCAACCCC
ACCCGTTGAACCAACCCCACCAACTGTCAAGCCAACACCACCCACAGTCAAGCCGACGCCACCAGCCACCCCACCAGCACCATGCCCGCCACCAACTCCA
TCTCCGATGCCACCGTCCCCACCTAAGAAAGACATGTGCCCCATCGACGCGCTCAAGCTAGGCGCGTGTGTGGACGTGTTGGGTGGGCTCGTCCACATTG
GAATCGGACAGAGTGCCAAGTCGACTTGCTGCCCTCTTGTCCAAGGGCTAGCTGATTTGGATGCTGCCTTGTGCCTTTGCACCACCATCAAGCTGAAGCT
TCTCAACGTCAACCTTATCCTCCCCATTGCTCTCGAAGTCCTCCTTGACTGTGGGAAGAACCCTCCTGCTGGTTTCAAGTGTCCTTCCTAG
AA sequence
>Lus10003801 pacid=23145959 polypeptide=Lus10003801 locus=Lus10003801.g ID=Lus10003801.BGIv1.0 annot-version=v1.0
MAKQYYSLASFLLFLVLNLGALIVPSLACPSCTLPPPPCPPTKPPHIKPTPPTVKPTPPVTPPVKPTPPTVKPTPPVKPTPPTVKPTPPVKPTPPTVKPT
PPVKPTPPTVKPTPPTVKPTPPVKPTPPTVKPTPPVKPTPPTVKPTPPVKPTPPTVKPTPPTVKPTPPVEPTPPTVKPTPPTVKPTPPATPPAPCPPPTP
SPMPPSPPKKDMCPIDALKLGACVDVLGGLVHIGIGQSAKSTCCPLVQGLADLDAALCLCTTIKLKLLNVNLILPIALEVLLDCGKNPPAGFKCPS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G22142 Bifunctional inhibitor/lipid-t... Lus10003801 0 1
AT4G40042 Microsomal signal peptidase 12... Lus10006422 3.0 0.8578
AT2G28790 Pathogenesis-related thaumatin... Lus10004954 3.5 0.8679
AT2G30620 winged-helix DNA-binding trans... Lus10006561 8.4 0.8336
AT5G48480 Lactoylglutathione lyase / gly... Lus10009580 13.4 0.8500
Lus10010480 17.3 0.8632
AT5G49665 Zinc finger (C3HC4-type RING f... Lus10028225 19.3 0.8313
AT5G66580 unknown protein Lus10000739 19.9 0.7614
AT1G27435 unknown protein Lus10041533 20.2 0.7638
AT4G26190 Haloacid dehalogenase-like hyd... Lus10017858 20.6 0.7997
AT2G30620 winged-helix DNA-binding trans... Lus10005535 21.4 0.8117

Lus10003801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.