Lus10003802 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22142 67 / 3e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G15160 64 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT1G62500 62 / 5e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G22120 61 / 1e-10 CWLP cell wall-plasma membrane linker protein (.1)
AT2G10940 61 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT1G62510 49 / 5e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G12500 46 / 6e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G12090 44 / 1e-05 ELP extensin-like protein (.1)
AT4G12470 42 / 0.0001 AZI1 azelaic acid induced 1 (.1)
AT5G46890 39 / 0.0005 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003801 151 / 4e-44 AT3G22142 168 / 7e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10010480 125 / 2e-35 ND 127 / 3e-34
Lus10010479 125 / 1e-34 AT3G22142 168 / 3e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10010482 115 / 1e-32 AT3G22142 162 / 5e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032262 68 / 5e-13 AT1G62500 162 / 3e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10032257 62 / 9e-12 AT4G12490 157 / 1e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10024622 61 / 7e-11 ND 130 / 1e-38
Lus10006191 58 / 2e-10 AT1G62510 103 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10004349 58 / 7e-10 AT1G62500 134 / 5e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G008300 91 / 8e-22 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G008500 89 / 1e-21 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1)
Potri.016G015500 86 / 1e-18 AT3G22142 161 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G065500 52 / 4e-08 AT2G10940 147 / 8e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.003G111300 52 / 1e-07 AT1G62500 125 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G158400 47 / 1e-06 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.018G025900 45 / 5e-06 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.003G111400 45 / 5e-06 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.018G126000 47 / 8e-06 AT2G10940 109 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.001G121900 44 / 1e-05 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10003802 pacid=23145948 polypeptide=Lus10003802 locus=Lus10003802.g ID=Lus10003802.BGIv1.0 annot-version=v1.0
ATGGGGAGGATAAGGTTGACGTTGAGAAGCTTCAGCTTGATGGTGGTGCAAAGGCACAAGGCAGCATCCAAATCAGCTAGCCCTTGGACAAGAGGGCAGC
AAGTCGACTTGGCACTCTGTCCGATTCCAATGTGGACGAGCCCACCCAACACGTCCACACACGCGCCTAGCTTGAGCGCGTCGATGGGGCACATGTCTTT
CTTAGGTGGGGACGGTGGCATCGGAGATGGAGTTGGTGGCGGGCATGGTGCTGGTGGGGTGGCTGGTGGCGTCGGCTTGACTGTGGGTGGTGTTGGCTTG
ACAGTTGGTGGGGTTGGTTCAACGGGTGGGGTTGGCTTGACAGTGGGTGGCGTTGGCTTGACAGTTGGGGGTGTTGGCTTCACGGGCGGTGTTGGCTTGA
CAGTAGGTGGTGTTGGCTTCACGGGTGGCGTTGGTTTGACAGTAGGTGGTGTTGGCTTCACGGGTGGTGTTGGTTTGACAGTAGGTGGCGTTGGCTTGAC
AGTTGGTGGTGTCGGCTTCACAGGTGGCGTTGGCTTGACAGTTGGTGGTGTCGGCTTCACAGGTGGCGTTGGCTTGACAGTTGGTGGTGTCGGCTTCACA
GGTGGCGTTGGCTTGACAGTTGGTGGTGTCGGCTTCACAGGTGGCGTCACAGGCGGTGTTGGCTTCACGGTGGGTGGTGTTGGCTTGATATGTGGTGGCT
TAGTTGGTGGGCAAGGAGGAGGAGGAAGAGTGCATGAAGGGCAAGCAAGAGAAGGAACAATCAAGGCTCCCAAGTTGAGAACCAAGAATAGCAAGAAGCT
AGCTAGAGAGTAG
AA sequence
>Lus10003802 pacid=23145948 polypeptide=Lus10003802 locus=Lus10003802.g ID=Lus10003802.BGIv1.0 annot-version=v1.0
MGRIRLTLRSFSLMVVQRHKAASKSASPWTRGQQVDLALCPIPMWTSPPNTSTHAPSLSASMGHMSFLGGDGGIGDGVGGGHGAGGVAGGVGLTVGGVGL
TVGGVGSTGGVGLTVGGVGLTVGGVGFTGGVGLTVGGVGFTGGVGLTVGGVGFTGGVGLTVGGVGLTVGGVGFTGGVGLTVGGVGFTGGVGLTVGGVGFT
GGVGLTVGGVGFTGGVTGGVGFTVGGVGLICGGLVGGQGGGGRVHEGQAREGTIKAPKLRTKNSKKLARE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003802 0 1
AT3G22142 Bifunctional inhibitor/lipid-t... Lus10010479 1.4 0.9752
AT3G08030 Protein of unknown function, D... Lus10016394 1.7 0.9701
AT3G08030 Protein of unknown function, D... Lus10019723 2.0 0.9762
Lus10026740 5.7 0.9678
AT5G11420 Protein of unknown function, D... Lus10019724 8.1 0.9666
AT5G11420 Protein of unknown function, D... Lus10005474 8.7 0.9483
AT2G40280 S-adenosyl-L-methionine-depend... Lus10017436 9.2 0.9119
AT1G43800 Plant stearoyl-acyl-carrier-pr... Lus10018926 9.4 0.9634
AT1G24530 Transducin/WD40 repeat-like su... Lus10036881 9.5 0.9594
AT5G25940 early nodulin-related (.1) Lus10030052 11.0 0.9653

Lus10003802 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.