Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22210 36 / 0.0001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G021100 [exp] 40 / 5e-06 AT3G22210 54 / 9e-12 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003811 pacid=23145947 polypeptide=Lus10003811 locus=Lus10003811.g ID=Lus10003811.BGIv1.0 annot-version=v1.0 ATGGACGGAGGAGCATTGCAGGTAGCTCTACCAGTGCTGGTAATCGTCGCCGCCGCAGTCGTCACTTTCTACGTTGTCAGCTTCTCCGAGATCCGTGAGA AATCCTTCAAAGATTTGGACGACCAAACTGGCGGCAGCTTCAAGTCATCTTTCCGGTCGAGGGAGCGTCGAGCTAGGAGGAACGCCGAGAAACAAAACAA GAACTAA
AA sequence Show only first row Show all	>Lus10003811 pacid=23145947 polypeptide=Lus10003811 locus=Lus10003811.g ID=Lus10003811.BGIv1.0 annot-version=v1.0 MDGGALQVALPVLVIVAAAVVTFYVVSFSEIREKSFKDLDDQTGGSFKSSFRSRERRARRNAEKQNKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22210			unknown protein		Lus10003811 [exp]	0	1
AT3G05870		APC11	anaphase-promoting complex/cyc...		Lus10031549 [exp]	3.0	0.8759
AT4G32915			unknown protein		Lus10006882 [exp]	5.3	0.8574
AT4G39710		PnsL4, FKBP16-2	Photosynthetic NDH subcomplex...		Lus10000197 [exp]	6.0	0.9103
AT3G55240			Plant protein 1589 of unknown ...		Lus10003293 [exp]	6.8	0.8609
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10006169 [exp]	10.6	0.8200
					Lus10019515 [exp]	12.8	0.8696
AT1G79850		PDE347, CS17, P...	PLASTID RIBOSOMAL SMALL SUBUNI...		Lus10025799 [exp]	16.5	0.9037
AT4G18370		DEGP5, DEG5, HH...	PROTEASE HHOA PRECUSOR, DEGP p...		Lus10042822 [exp]	18.0	0.9012
AT1G49975			unknown protein		Lus10033771 [exp]	20.0	0.8895
AT4G04900		RIC10	ROP-interactive CRIB motif-con...		Lus10018362 [exp]	24.0	0.8100

Compare expression of checked genes

Lus10003811 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.