Lus10003814 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G15000 201 / 1e-67 Ribosomal L27e protein family (.1.2)
AT3G22230 200 / 1e-67 Ribosomal L27e protein family (.1)
AT2G32220 184 / 2e-61 Ribosomal L27e protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010461 224 / 4e-77 AT4G15000 236 / 7e-82 Ribosomal L27e protein family (.1.2)
Lus10039017 205 / 3e-69 AT4G15000 232 / 3e-80 Ribosomal L27e protein family (.1.2)
Lus10027314 202 / 4e-68 AT4G15000 233 / 2e-80 Ribosomal L27e protein family (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G021500 206 / 1e-69 AT4G15000 205 / 2e-69 Ribosomal L27e protein family (.1.2)
Potri.016G019000 202 / 3e-68 AT4G15000 209 / 5e-71 Ribosomal L27e protein family (.1.2)
Potri.001G342500 199 / 3e-67 AT4G15000 210 / 2e-71 Ribosomal L27e protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01777 Ribosomal_L27e Ribosomal L27e protein family
CL0107 KOW PF00467 KOW KOW motif
Representative CDS sequence
>Lus10003814 pacid=23145974 polypeptide=Lus10003814 locus=Lus10003814.g ID=Lus10003814.BGIv1.0 annot-version=v1.0
ATGGTGAAGTTCCTGAAGCCGAACAAGGCCGTGATCGTCCTCCAGGGCCGTTACGCCGGGCGCAAGGCCGTCATTGTCAAGAACTTCGACGACGGCACCA
AGGACCGCGGCTACGGCCACTGCTTGGTCGCCGGAATCAAGAAGTACCCCGGCAAGGTCATCAGGAAGGATTCGGCCAAGAAGACCGCTAAGAAGTCTCG
CGTCAAGTGCTTCGTCAAGCTCGTCAACTACAGGCATCTGATGCCGACTCGCTACACGCTGGACGTGGACTTGAAGGATGTTGTTACTCCCGATGTGTTG
CAGAGCAAGGAGAAGAAGGTCGCCGCTTCTAAGGAGGCCAAGGCGAAGTTTGAGGAGAGGTTCAAGACTGGGAAGAACAGGTGGTTCTTTACCAAGCTCA
GGTTTTAA
AA sequence
>Lus10003814 pacid=23145974 polypeptide=Lus10003814 locus=Lus10003814.g ID=Lus10003814.BGIv1.0 annot-version=v1.0
MVKFLKPNKAVIVLQGRYAGRKAVIVKNFDDGTKDRGYGHCLVAGIKKYPGKVIRKDSAKKTAKKSRVKCFVKLVNYRHLMPTRYTLDVDLKDVVTPDVL
QSKEKKVAASKEAKAKFEERFKTGKNRWFFTKLRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G15000 Ribosomal L27e protein family ... Lus10003814 0 1
AT5G09510 Ribosomal protein S19 family p... Lus10033856 3.7 0.9488
AT2G09990 Ribosomal protein S5 domain 2-... Lus10035133 5.5 0.9443
AT2G32060 Ribosomal protein L7Ae/L30e/S1... Lus10021027 6.6 0.9044
AT4G16720 Ribosomal protein L23/L15e fam... Lus10028965 8.0 0.9426
AT5G35530 Ribosomal protein S3 family pr... Lus10030503 8.6 0.9460
AT3G51800 ATEBP1, ATG2, E... A. THALIANA ERBB-3 BINDING PRO... Lus10002851 9.7 0.9419
AT5G59850 Ribosomal protein S8 family pr... Lus10023429 10.4 0.9270
AT5G11880 Pyridoxal-dependent decarboxyl... Lus10023548 13.1 0.8958
AT4G13850 ATGRP2, GR-RBP2 glycine rich protein 2, glycin... Lus10022551 14.8 0.9243
AT2G42740 RPL16A ribosomal protein large subuni... Lus10017648 15.5 0.9371

Lus10003814 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.