Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22240 52 / 9e-11 unknown protein AT2G32210 49 / 1e-09 unknown protein AT2G32190 49 / 2e-09 unknown protein AT2G32200 47 / 2e-08 unknown protein AT1G05340 42 / 1e-06 unknown protein AT3G22231 36 / 0.0003 PCC1 pathogen and circadian controlled 1 (.1) AT3G22235 36 / 0.0003 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010460 [exp] 120 / 1e-37 AT2G32190 79 / 3e-21 unknown protein Lus10039015 [exp] 65 / 1e-15 AT2G32190 76 / 3e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G019201 [exp] 49 / 2e-09 AT1G05340 / unknown protein Potri.006G021600 [exp] 42 / 9e-07 AT1G05340 / unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003815 pacid=23145973 polypeptide=Lus10003815 locus=Lus10003815.g ID=Lus10003815.BGIv1.0 annot-version=v1.0 ATGACTCAGATCGATCAGCAATTCGCCGCCGCACCTACTTCCTCCGGAGCGTCGTATTCATACGAGCTTCCGAAATCGAGCGGGTCGTACGTTGTTGCAG CGCCTCCGCCGATTGGGTACCCGACCCGGGACGCCGGCGACGCAGCTGTACCGATTGAGACCAAGTCCAAGGGAGACGGCTTCTGGAAAGGATGTTGTGC TGCCTTGTGCTGTTGCTGTGTCTTGGACGCCTGCTTCTGA
AA sequence Show only first row Show all	>Lus10003815 pacid=23145973 polypeptide=Lus10003815 locus=Lus10003815.g ID=Lus10003815.BGIv1.0 annot-version=v1.0 MTQIDQQFAAAPTSSGASYSYELPKSSGSYVVAAPPPIGYPTRDAGDAAVPIETKSKGDGFWKGCCAALCCCCVLDACF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G32210			unknown protein		Lus10003815 [exp]	0	1
AT5G54840		ATSGP1	Ras-related small GTP-binding ...		Lus10019615 [exp]	3.5	0.9442
AT5G49710			unknown protein		Lus10015965 [exp]	3.6	0.9538
AT4G30340		ATDGK7	diacylglycerol kinase 7 (.1)		Lus10015514 [exp]	4.9	0.9468
AT5G03380			Heavy metal transport/detoxifi...		Lus10023924 [exp]	5.2	0.9467
AT2G34930			disease resistance family prot...		Lus10021973 [exp]	7.6	0.9133
AT3G62420	bZIP	ATBZIP53	basic region/leucine zipper mo...		Lus10010005 [exp]	8.5	0.9359
AT4G18360			Aldolase-type TIM barrel famil...		Lus10038507 [exp]	10.9	0.9353
AT2G32190			unknown protein		Lus10039015 [exp]	11.8	0.9295
AT5G18270	NAC	ANAC087	Arabidopsis NAC domain contain...		Lus10026879 [exp]	14.4	0.9252
AT3G12250	bZIP	BZIP45, TGA6	TGACG motif-binding factor 6 (...		Lus10008658 [exp]	14.6	0.9095

Compare expression of checked genes

Lus10003815 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.