Lus10003816 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22260 287 / 6e-99 Cysteine proteinases superfamily protein (.1.2.3)
AT3G02070 235 / 9e-79 Cysteine proteinases superfamily protein (.1)
AT5G03330 185 / 2e-57 Cysteine proteinases superfamily protein (.1.2)
AT5G04250 185 / 3e-57 Cysteine proteinases superfamily protein (.1.2)
AT2G39320 76 / 4e-17 Cysteine proteinases superfamily protein (.1)
AT5G67170 56 / 6e-09 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
AT2G27350 47 / 5e-06 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010459 372 / 2e-132 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3)
Lus10027312 295 / 4e-101 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Lus10038708 187 / 7e-58 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2)
Lus10037977 184 / 1e-56 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2)
Lus10026525 179 / 3e-55 AT5G03330 292 / 4e-97 Cysteine proteinases superfamily protein (.1.2)
Lus10001404 173 / 9e-53 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2)
Lus10023019 173 / 1e-52 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2)
Lus10013813 171 / 6e-52 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2)
Lus10037388 158 / 3e-47 AT5G04250 239 / 6e-77 Cysteine proteinases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G021700 318 / 3e-111 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.016G019700 300 / 4e-104 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
Potri.014G140200 247 / 3e-83 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.006G125900 190 / 3e-59 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2)
Potri.016G094700 189 / 4e-59 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2)
Potri.010G225400 184 / 1e-56 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036700 178 / 2e-54 AT5G04250 372 / 2e-128 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036900 155 / 7e-48 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2)
Potri.005G140500 59 / 3e-10 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Potri.009G160100 44 / 5e-05 AT2G27350 440 / 3e-150 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Lus10003816 pacid=23145968 polypeptide=Lus10003816 locus=Lus10003816.g ID=Lus10003816.BGIv1.0 annot-version=v1.0
ATGACCGAAAGCCACAGCAACGCGAGTGCAAGCTCGACTTCTAGTTTTAGTAGCAGCACTGCTGATACAGAGGATGATCAAGTCATTGCAAGCATCTTAG
CTGAAGAAGAAAAGGCTAACGCTGGTAGACAGCTTGGAAAGAGGCTCTCTCATTTAGATTCTATACCTCACACTCTTCGCGTTAATGGCGAGATTCCAGA
TTTGAACGACGCAACCTTAGATCATGTACGGCTTTCTGAAAGAGTAGTCCATAACTCGTGCCTTCTTGTTCAAGTTATCAAATTTCGAGCACTGGCAGAC
CAGTTGTTCCGCAGTCCAGATTATCACAAACATGTCAGGAAGCAAGTGGTGAAGCAGCTAAAGCAATTCAGAAAGTTTTACGAAAGCCATGTCCCGATGA
AGTACAAAAGCTACATTAGAAAGATGAAAAAATCAGGAGAGTGGGGTGATCACGTCACTCTACAAGCTGCTGCAGATCGATTTGAAGCCAAGATTTGCTT
AGTTACATCTTTTCGCGACACTTGCTACATCGAGATCCGGCCCAAGGACAAGCCTCCCGGGAGAGAGATCTGGCTAAGCTTTTGGAGTGAAGTTCACTAT
AATTCACTATATGCAATTGGAGATGTTCCCACCAGAGTACCAAGGAAAAGGCATTGGCTCTTCTGA
AA sequence
>Lus10003816 pacid=23145968 polypeptide=Lus10003816 locus=Lus10003816.g ID=Lus10003816.BGIv1.0 annot-version=v1.0
MTESHSNASASSTSSFSSSTADTEDDQVIASILAEEEKANAGRQLGKRLSHLDSIPHTLRVNGEIPDLNDATLDHVRLSERVVHNSCLLVQVIKFRALAD
QLFRSPDYHKHVRKQVVKQLKQFRKFYESHVPMKYKSYIRKMKKSGEWGDHVTLQAAADRFEAKICLVTSFRDTCYIEIRPKDKPPGREIWLSFWSEVHY
NSLYAIGDVPTRVPRKRHWLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G22260 Cysteine proteinases superfami... Lus10003816 0 1
AT5G03330 Cysteine proteinases superfami... Lus10026525 4.2 0.9452
AT1G21000 PLATZ transcription factor fam... Lus10002700 5.5 0.9594
AT2G31870 PARG1, TEJ Sanskrit for 'bright', poly\(A... Lus10020902 7.7 0.9406
AT4G34030 MCCB 3-methylcrotonyl-CoA carboxyla... Lus10014068 8.1 0.9500
AT4G21380 ARK3 receptor kinase 3 (.1) Lus10028782 10.6 0.9325
AT2G17080 Arabidopsis protein of unknown... Lus10025124 11.1 0.9446
AT3G50210 2-oxoglutarate (2OG) and Fe(II... Lus10006259 13.8 0.9433
AT3G04970 DHHC-type zinc finger family p... Lus10018967 14.1 0.9408
AT1G18270 ketose-bisphosphate aldolase c... Lus10008754 14.1 0.9416
AT4G35110 Arabidopsis phospholipase-like... Lus10042396 15.0 0.9374

Lus10003816 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.