Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56890 76 / 2e-16 Protein kinase superfamily protein (.1) AT2G20300 74 / 1e-15 ALE2 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) AT2G37050 58 / 5e-10 Leucine-rich repeat protein kinase family protein (.1.2.3) AT5G59670 57 / 1e-09 Leucine-rich repeat protein kinase family protein (.1) AT1G49270 57 / 1e-09 AtPERK7 proline-rich extensin-like receptor kinase 7, Protein kinase superfamily protein (.1) AT4G23220 56 / 1e-09 CRK14 cysteine-rich RLK (RECEPTOR-like protein kinase) 14 (.1) AT3G09010 56 / 1e-09 Protein kinase superfamily protein (.1) AT3G24540 56 / 2e-09 AtPERK3 proline-rich extensin-like receptor kinase 3, Protein kinase superfamily protein (.1) AT3G24790 55 / 4e-09 Protein kinase superfamily protein (.1) AT4G04570 55 / 4e-09 CRK40 cysteine-rich RLK (RECEPTOR-like protein kinase) 40 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 40 (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027635 [exp] 81 / 8e-18 AT5G56890 887 / 0.0 Protein kinase superfamily protein (.1) Lus10011933 [exp] 79 / 2e-17 AT5G56890 880 / 0.0 Protein kinase superfamily protein (.1) Lus10022848 [exp] 73 / 2e-15 AT2G20300 912 / 0.0 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) Lus10011917 [exp] 73 / 2e-15 AT2G20300 951 / 0.0 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) Lus10020052 [exp] 60 / 1e-10 AT1G11340 858 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10006745 [exp] 58 / 5e-10 AT1G11340 774 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10009631 [exp] 56 / 1e-09 AT4G21390 343 / 2e-115 S-locus lectin protein kinase family protein (.1) Lus10020078 [exp] 56 / 2e-09 AT1G11340 257 / 1e-80 S-locus lectin protein kinase family protein (.1) Lus10023166 [exp] 56 / 2e-09 AT2G37050 1323 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G068100 [exp] 80 / 1e-17 AT5G56890 801 / 0.0 Protein kinase superfamily protein (.1) Potri.006G152000 [exp] 78 / 4e-17 AT5G56890 846 / 0.0 Protein kinase superfamily protein (.1) Potri.014G194300 [exp] 78 / 6e-17 AT2G20300 966 / 0.0 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) Potri.002G254600 [exp] 77 / 8e-17 AT2G20300 947 / 0.0 Abnormal Leaf Shape 2, Protein kinase superfamily protein (.1) Potri.004G027400 [exp] 59 / 1e-10 AT1G11330 872 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.004G153600 [exp] 59 / 2e-10 AT4G34440 551 / 0.0 proline-rich extensin-like receptor kinase 5, Protein kinase superfamily protein (.1) Potri.011G027501 [exp] 59 / 3e-10 AT4G23180 553 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G023550 [exp] 58 / 4e-10 AT4G05200 541 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.006G132100 [exp] 58 / 5e-10 AT2G37050 1317 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2.3) Potri.011G027700 [exp] 57 / 6e-10 AT4G05200 373 / 3e-122 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF07714 [flax] [poplar] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Lus10003827 pacid=23162608 polypeptide=Lus10003827 locus=Lus10003827.g ID=Lus10003827.BGIv1.0 annot-version=v1.0 ATGAGGTTGTTGCTTGTGGTGGTAATATGGACATTGTCAGTTCATGGTATCTCAGTTCTCGGATCTGCAGAAAATGGAAACGAGATTGCTGTGAAGGTGT TAAAAAGATATGATCAGCATGGAAGCCGGGAGGTCCTCGCTGAAGTTGAGATGCTCAGCCGGCTGCATCACAGAAATCTTGTCAAGCTAATTGGAACTTG TTCTGAGGGCCCACTCGCTGCCTTGTTTATGAACCCATTCCCAATGGAAGCCTTGAATCGCACTTACATGGAGTTGATAAGGAATCTAATCCACTTTACA GGGATGTTTATGGATGTTTTGCATTCCCATTGCGTGCTTCATTTGTCAACTTCCGATCTGTTGAGCTCAAGCTTTGGACTCGAAGAAGGGCAGGTTTCTG AATCTCATAGAGCACATTCGGCCTCTGGACCATTGATAACAGGGATAAAGAGACAGCTTTGGCAGAAGTTTAGAGGCAGCAGAAGTGAGCATGGGTTTCC AGTTAAATTATGGTCTGGAACTAGCTAA
AA sequence Show only first row Show all	>Lus10003827 pacid=23162608 polypeptide=Lus10003827 locus=Lus10003827.g ID=Lus10003827.BGIv1.0 annot-version=v1.0 MRLLLVVVIWTLSVHGISVLGSAENGNEIAVKVLKRYDQHGSREVLAEVEMLSRLHHRNLVKLIGTCSEGPLAALFMNPFPMEALNRTYMELIRNLIHFT GMFMDVLHSHCVLHLSTSDLLSSSFGLEEGQVSESHRAHSASGPLITGIKRQLWQKFRGSRSEHGFPVKLWSGTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20300		ALE2	Abnormal Leaf Shape 2, Protein...		Lus10003827 [exp]	0	1
AT4G15560		AtCLA1, DXS, DX...	1-DEOXY-D-XYLULOSE 5-PHOSPHATE...		Lus10033987 [exp]	4.8	0.8442
AT2G22420			Peroxidase superfamily protein...		Lus10035925 [exp]	4.9	0.7933
AT3G10050		OMR1	L-O-methylthreonine resistant ...		Lus10020520 [exp]	5.0	0.7872
AT3G53850			Uncharacterised protein family...		Lus10010881 [exp]	5.7	0.7762
AT5G44230			Pentatricopeptide repeat (PPR)...		Lus10022090 [exp]	5.7	0.7582
AT4G26410			Uncharacterised conserved prot...		Lus10035249 [exp]	6.5	0.7841
AT3G47600	MYB	ATMYB94, AtMYBC...	myb domain protein 94 (.1)		Lus10005245 [exp]	12.0	0.7705
AT5G43830			Aluminium induced protein with...		Lus10041181 [exp]	16.1	0.7664
AT3G29320		PHS1	alpha-glucan phosphorylase 1, ...		Lus10036892 [exp]	21.3	0.8104
AT1G74710		ATICS1, SID2, E...	SALICYLIC ACID INDUCTION DEFIC...		Lus10023622 [exp]	24.3	0.7954

Compare expression of checked genes

Lus10003827 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.