Lus10003843 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10003843 pacid=23166690 polypeptide=Lus10003843 locus=Lus10003843.g ID=Lus10003843.BGIv1.0 annot-version=v1.0
ATGCATTGCAAATTTTGCAAAGGAGGAGGCCACAATACTCGATCGTGTCCATTAAAGCCACATGCACCTACAACTAAAGCTGGACCCTCACGTGGAAGGG
CACGTCGTAGAACCAAGGTATCAATTCCTACTCCAAGGTCACGTACTACCAAATGTGGTACTTATGGAGGAGGGGGCCATGACACGAGGACTTGTCCTTG
TAACATAGGTGTACATGCAACCCTAAACCCTGACACAAGCGGGTACAACAAAGAGAGATGGGACAAGTTATGCAAGGGGCGGGGCGTTCCAGTGCGAGGA
AACAGGAAATATGTACTTTTGTGGAACATATCGTGTACTAGGAGGGGGTTGAAGACCTCAAGTGATGGAAGTGCATGGTTCCCAGCCACTAGGAACCCAA
CCGTCTCAGTGATAGATTGCCATATTTTCCAGTACGCTTAG
AA sequence
>Lus10003843 pacid=23166690 polypeptide=Lus10003843 locus=Lus10003843.g ID=Lus10003843.BGIv1.0 annot-version=v1.0
MHCKFCKGGGHNTRSCPLKPHAPTTKAGPSRGRARRRTKVSIPTPRSRTTKCGTYGGGGHDTRTCPCNIGVHATLNPDTSGYNKERWDKLCKGRGVPVRG
NRKYVLLWNISCTRRGLKTSSDGSAWFPATRNPTVSVIDCHIFQYA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003843 0 1
AT1G18100 MFT, E12A11 MOTHER OF FT AND TFL1, PEBP (p... Lus10002592 2.0 1.0000
Lus10022996 2.2 1.0000
Lus10001326 2.4 1.0000
AT4G13090 XTH2 xyloglucan endotransglucosylas... Lus10025919 3.5 1.0000
Lus10004351 3.5 1.0000
AT4G22756 ATSMO1-2, ATSMO... sterol C4-methyl oxidase 1-2 (... Lus10028908 4.5 1.0000
AT5G35750 AHK2 histidine kinase 2 (.1) Lus10009736 4.9 1.0000
AT1G07985 Expressed protein (.1) Lus10029516 4.9 1.0000
Lus10027374 5.7 1.0000
AT3G26950 unknown protein Lus10035179 6.2 1.0000

Lus10003843 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.