Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08790 146 / 6e-45 NAC ATAF2, ANAC081 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G01720 144 / 4e-44 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G63790 139 / 5e-42 NAC ANAC102 NAC domain containing protein 102 (.1) AT1G77450 137 / 1e-41 NAC ANAC032 NAC domain containing protein 32 (.1) AT3G15500 130 / 3e-38 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT1G52890 130 / 4e-38 NAC ANAC019 NAC domain containing protein 19 (.1) AT4G27410 129 / 4e-38 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT1G61110 123 / 2e-35 NAC ANAC025 NAC domain containing protein 25 (.1) AT3G04070 121 / 1e-34 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT3G15510 120 / 3e-34 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020883 [exp] 155 / 2e-48 AT5G08790 320 / 6e-110 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10033493 [exp] 155 / 5e-48 AT5G08790 315 / 4e-108 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10042731 [exp] 142 / 4e-43 AT1G01720 414 / 7e-147 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10018142 [exp] 140 / 3e-42 AT1G01720 401 / 7e-142 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10025690 [exp] 140 / 3e-42 AT1G01720 405 / 1e-143 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10029692 [exp] 127 / 1e-37 AT1G01720 268 / 9e-90 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10018469 [exp] 128 / 4e-37 AT1G61110 301 / 5e-101 NAC domain containing protein 25 (.1) Lus10032657 [exp] 128 / 7e-37 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10043095 [exp] 128 / 7e-37 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G069500 [exp] 152 / 8e-47 AT1G01720 357 / 3e-124 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.007G099400 [exp] 150 / 4e-46 AT1G01720 366 / 6e-128 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G180200 [exp] 147 / 4e-45 AT1G01720 392 / 9e-139 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.002G081000 [exp] 145 / 2e-44 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.001G404100 [exp] 133 / 2e-39 AT4G27410 370 / 8e-129 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.011G123300 [exp] 132 / 5e-39 AT4G27410 354 / 2e-122 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.011G046700 [exp] 127 / 5e-37 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.001G404400 [exp] 127 / 7e-37 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.004G038000 [exp] 127 / 8e-37 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.011G123500 [exp] 127 / 9e-37 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10003848 pacid=23163336 polypeptide=Lus10003848 locus=Lus10003848.g ID=Lus10003848.BGIv1.0 annot-version=v1.0 ATGAACTCGCCGTCAACAGCGGTGGAAGATCAGCTCAGTTTACCAGCAGGGTTCAGATTCCACCCCACTGACGACGAGCTCGTCACCCATTACCTCTGCC GGAAATACTCCGATCAGAAACCCGCCGCCCCAATTATCGCCGAGCTCGACCTCTACAAATTCGACCCATGGGAGCTTCCCAAAATGGCGATGTATGGGGA GAAAGAGTGGTACTTCTTCTCGCCCAGGGATCGGAAATACCCGAACGGGTCGCGGCCGAACCGGGCGGCCGGTTTTTGGTTGTCTTTACTGTCTTCAGTT GGATGA
AA sequence Show only first row Show all	>Lus10003848 pacid=23163336 polypeptide=Lus10003848 locus=Lus10003848.g ID=Lus10003848.BGIv1.0 annot-version=v1.0 MNSPSTAVEDQLSLPAGFRFHPTDDELVTHYLCRKYSDQKPAAPIIAELDLYKFDPWELPKMAMYGEKEWYFFSPRDRKYPNGSRPNRAAGFWLSLLSSV G

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G08790	NAC	ATAF2, ANAC081	Arabidopsis NAC domain contain...		Lus10003848 [exp]	0	1
AT2G46150			Late embryogenesis abundant (L...		Lus10027178 [exp]	1.4	0.8057
AT1G73830	bHLH	bHLH050, BEE3	BR enhanced expression 3 (.1.2...		Lus10009034 [exp]	2.4	0.7976
AT2G39980			HXXXD-type acyl-transferase fa...		Lus10028267 [exp]	8.8	0.7479
AT1G21200	Trihelix		sequence-specific DNA binding ...		Lus10042805 [exp]	11.3	0.7251
AT1G07530	GRAS	SCL14, ATGRAS2	GRAS \(GAI, RGA, SCR\) 2, ARAB...		Lus10040787 [exp]	13.2	0.7553
AT3G22560			Acyl-CoA N-acyltransferases (N...		Lus10010569 [exp]	15.3	0.6974
AT1G67810		SUFE2	sulfur E2 (.1)		Lus10011408 [exp]	17.7	0.7645
AT1G20225			Thioredoxin superfamily protei...		Lus10005616 [exp]	18.9	0.7559
AT5G08790	NAC	ATAF2, ANAC081	Arabidopsis NAC domain contain...		Lus10002083 [exp]	21.2	0.7107
AT3G46600	GRAS		GRAS family transcription fact...		Lus10040789 [exp]	25.1	0.7541

Compare expression of checked genes

Lus10003848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.