Lus10003849 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64040 170 / 1e-54 PSAN, PSI-N photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.1), photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002084 224 / 5e-76 AT5G64040 216 / 8e-73 photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.1), photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G063300 167 / 1e-53 AT5G64040 224 / 5e-76 photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.1), photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.2)
Potri.007G105900 165 / 1e-52 AT5G64040 231 / 1e-78 photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.1), photosystem I reaction center subunit PSI-N, chloroplast, putative / PSI-N, putative (PSAN) (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05479 PsaN Photosystem I reaction centre subunit N (PSAN or PSI-N)
Representative CDS sequence
>Lus10003849 pacid=23163343 polypeptide=Lus10003849 locus=Lus10003849.g ID=Lus10003849.BGIv1.0 annot-version=v1.0
ATGGCTGCCACCAGCATGATGATGAGCTCCTCTTCCAGTGTCCTTGCCTGCAAGTACACTACCAAATCTTCATCATCAACCACCAGGAAGTTCCCAGTGA
TCAGAGCTCAGCAAGGAGATCGTGAAGCTGGAAATGGGAAAAAGGCTGCAGTGGCTTTCCTTGCAGCTACACTGTTTGCCACTGCAACTGTTTCTACTTC
CTTCTCGGCCAACGCTGGTGTCATTGATGACTACCTTGAGAAGAGCAAAGTCAACAAGGAATTGAATGACCAGAAGAGGCTGGCAACAAGTGGAGCAAAC
TTTGCAAGAGCATACACTGTCCAGTTTGGCTCCTGCAAGTTCCCTGAGAACTTCACTGGCTGCCAGGATCTTGCCAAGCAAAAGAAAGTTCCATTCATCT
CTGAGGATTTGGAGTTGGAGTGCAAAGGAAAAGACAAGTACAAGTGTGGCTCTAATGGTTTCTTGGAATGGTGA
AA sequence
>Lus10003849 pacid=23163343 polypeptide=Lus10003849 locus=Lus10003849.g ID=Lus10003849.BGIv1.0 annot-version=v1.0
MAATSMMMSSSSSVLACKYTTKSSSSTTRKFPVIRAQQGDREAGNGKKAAVAFLAATLFATATVSTSFSANAGVIDDYLEKSKVNKELNDQKRLATSGAN
FARAYTVQFGSCKFPENFTGCQDLAKQKKVPFISEDLELECKGKDKYKCGSNGFLEW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64040 PSAN, PSI-N photosystem I reaction center ... Lus10003849 0 1
AT1G67700 unknown protein Lus10006442 2.4 0.9702
AT5G64040 PSAN, PSI-N photosystem I reaction center ... Lus10002084 2.6 0.9793
AT2G44920 Tetratricopeptide repeat (TPR)... Lus10002712 3.5 0.9518
AT1G51400 Photosystem II 5 kD protein (.... Lus10009950 6.3 0.9568
AT1G52230 PSAH2, PSAH-2, ... PHOTOSYSTEM I SUBUNIT H-2, pho... Lus10025798 7.1 0.9659
AT2G38570 unknown protein Lus10014180 7.7 0.9280
AT1G30380 PSAK photosystem I subunit K (.1) Lus10012086 8.9 0.9600
AT1G65260 VIPP1, PTAC4 VESICLE-INDUCING PROTEIN IN PL... Lus10025601 8.9 0.9388
AT1G79040 PSBR photosystem II subunit R (.1) Lus10026205 9.2 0.9592
AT1G06240 Protein of unknown function DU... Lus10033620 10.3 0.9130

Lus10003849 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.