Lus10003860 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005943 45 / 8e-07 AT1G03010 881 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10029443 41 / 3e-05 AT1G03010 496 / 4e-172 Phototropic-responsive NPH3 family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10003860 pacid=23163339 polypeptide=Lus10003860 locus=Lus10003860.g ID=Lus10003860.BGIv1.0 annot-version=v1.0
ATGGCTGCGGAAGTGTTGCATACAGCTCACTCTGGTTTCTCGAAATGGAAGGATTTGGAAGCTGTTACTGGAATCAAAAGACTGCAACAAGGTTTCCAAG
ATAAACAGATTCATGTTATCTCTAGTGGAGCCGAAGCATTCCAAGCAGCTGTAAAATTTCGCTACGGAATCCAAGACGGAGAATCGCCGGTAACGACCCT
GACCCTACAGGCGCAGCATGGGACTCCGCCATCTGATTTCCCCTGGGATGGCTTCGGATGA
AA sequence
>Lus10003860 pacid=23163339 polypeptide=Lus10003860 locus=Lus10003860.g ID=Lus10003860.BGIv1.0 annot-version=v1.0
MAAEVLHTAHSGFSKWKDLEAVTGIKRLQQGFQDKQIHVISSGAEAFQAAVKFRYGIQDGESPVTTLTLQAQHGTPPSDFPWDGFG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10003860 0 1
AT3G10920 MSD1, MEE33, AT... MATERNAL EFFECT EMBRYO ARREST ... Lus10030534 8.9 0.9340
Lus10003802 12.6 0.9251
AT3G09950 unknown protein Lus10039065 14.3 0.9064
AT2G18670 RING/U-box superfamily protein... Lus10019979 15.6 0.9253
AT2G36530 ENO2, LOS2 LOW EXPRESSION OF OSMOTICALLY ... Lus10015028 19.5 0.9225
AT4G33070 Thiamine pyrophosphate depende... Lus10015291 20.5 0.9216
AT3G22142 Bifunctional inhibitor/lipid-t... Lus10010479 26.3 0.9142
AT5G39890 Protein of unknown function (D... Lus10003861 28.2 0.9197
AT5G62750 unknown protein Lus10042178 30.4 0.9130
AT2G26060 EMB1345 embryo defective 1345, Transdu... Lus10021365 30.8 0.9130

Lus10003860 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.