Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013622 [exp] 89 / 6e-25 ND 35 / 0.002
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G064501 [exp] 39 / 0.0001 AT3G03760 209 / 1e-67 LOB domain-containing protein 20 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003863 pacid=23163353 polypeptide=Lus10003863 locus=Lus10003863.g ID=Lus10003863.BGIv1.0 annot-version=v1.0 ATGATCCAAAGTCAGCTGATAAACAGCAGATACGCCATTGCAAATGTTCTTCAGAATTCCCAGCAACAGCAGCAGCAGCAGCAGCAAGTTGCAATGCTCC AGCCGGCATACTCCAACAACTCCTCTGCTTCCACCAACCTCCTTAACCTCGCTAGCTTCAACACCTCCAACTTCGACCTCGCCCCGAATCCTGCTCCTCC TGTCGACGAAGAAAGCCGCATCCCAACTACGTTCCACGACGACATCCTTCGCCCAAGATGA
AA sequence Show only first row Show all	>Lus10003863 pacid=23163353 polypeptide=Lus10003863 locus=Lus10003863.g ID=Lus10003863.BGIv1.0 annot-version=v1.0 MIQSQLINSRYAIANVLQNSQQQQQQQQQVAMLQPAYSNNSSASTNLLNLASFNTSNFDLAPNPAPPVDEESRIPTTFHDDILRPR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10003863 [exp]	0	1
AT3G26660	AS2	LBD24	LOB domain-containing protein ...		Lus10018993 [exp]	2.4	0.8049
AT2G32415			Polynucleotidyl transferase, r...		Lus10031563 [exp]	10.1	0.8169
AT4G21380		ARK3	receptor kinase 3 (.1)		Lus10037733 [exp]	22.2	0.7917
AT1G77410		BGAL16	beta-galactosidase 16 (.1)		Lus10018138 [exp]	24.0	0.8134
AT5G60740		ABCG28	ATP-binding cassette G28, ABC ...		Lus10016115 [exp]	24.4	0.7701
AT3G48560		TZP5, IMR1, ALS...	TRIAZOLOPYRIMIDINE RESISTANT 5...		Lus10032037 [exp]	26.5	0.8094
					Lus10000768 [exp]	29.9	0.7668
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10009480 [exp]	42.5	0.7953
					Lus10000578 [exp]	43.1	0.7833
					Lus10016852 [exp]	44.2	0.7276

Compare expression of checked genes

Lus10003863 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.