Lus10003865 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G28740 74 / 2e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022346 76 / 5e-17 AT5G28740 905 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10041573 73 / 3e-16 AT5G28740 1386 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G035600 76 / 3e-17 AT5G28740 1418 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10003865 pacid=23163335 polypeptide=Lus10003865 locus=Lus10003865.g ID=Lus10003865.BGIv1.0 annot-version=v1.0
ATGGAGAAGCAGTCTGTAGTAGTTAGTACCATCAACAGCAGGAAAATATATGGGTTTGTAAGTGCAGGAGTACTACAGACACAGACTTGTGGTGAGGTAA
AAGTTTCCACGAATAATGGAGAAGACATCGAGCTTCCCAAAGAAAGTGACTTGGACGACGACGATGATGAGAGCGCCGAAATCGCTCAAAAGGTTGTGCC
CTCTGCCGTGTTTGGAGGATTGGTTAGGAAGAGGGTTTTTTCGGAGATAGGCGGCTGTGAGGGCCATGCTCCATCGGATGGTGAAAGCCGGCTGCTAGGT
GCTCTTCAGAGGATAAAACGACTTAAACAATAG
AA sequence
>Lus10003865 pacid=23163335 polypeptide=Lus10003865 locus=Lus10003865.g ID=Lus10003865.BGIv1.0 annot-version=v1.0
MEKQSVVVSTINSRKIYGFVSAGVLQTQTCGEVKVSTNNGEDIELPKESDLDDDDDESAEIAQKVVPSAVFGGLVRKRVFSEIGGCEGHAPSDGESRLLG
ALQRIKRLKQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G28740 Tetratricopeptide repeat (TPR)... Lus10003865 0 1
Lus10029069 10.1 0.6791
Lus10022574 11.5 0.7257
AT1G05675 UDP-Glycosyltransferase superf... Lus10024118 16.9 0.7619
AT3G18150 RNI-like superfamily protein (... Lus10014142 17.9 0.7410
AT3G59140 ATMRP14, ABCC10 ATP-binding cassette C10, mult... Lus10027567 42.2 0.7291
Lus10015577 60.8 0.6455
AT5G48850 ATSDI1 SULPHUR DEFICIENCY-INDUCED 1, ... Lus10011872 68.3 0.6922
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Lus10000203 73.8 0.6774
AT2G47810 CCAAT NF-YB5 "nuclear factor Y, subunit B5"... Lus10036574 83.2 0.6897
AT4G20140 GSO1 GASSHO1, Leucine-rich repeat t... Lus10033519 100.3 0.6847

Lus10003865 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.