Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G28740 66 / 2e-14 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022347 [exp] 82 / 1e-21 AT5G28740 301 / 3e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10041573 [exp] 80 / 2e-19 AT5G28740 1386 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G035600 [exp] 79 / 3e-19 AT5G28740 1418 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003867 pacid=23163330 polypeptide=Lus10003867 locus=Lus10003867.g ID=Lus10003867.BGIv1.0 annot-version=v1.0 ATGTCGATCTCCAGCTCTCTGTATCCGTCGCCGGACGATCTTCCCTACGAAGAAGAGCTGTTGCGGAATCCATTCAGCCTGAAGCTATGGTGGCGCTACC TGGTGGCCCGACGACAAGCTCCGTTCAAGCAGCGTGAAGTGATATACGAGAGGGCAGTCAAGGCTTTGCCCGGAAGTTAG
AA sequence Show only first row Show all	>Lus10003867 pacid=23163330 polypeptide=Lus10003867 locus=Lus10003867.g ID=Lus10003867.BGIv1.0 annot-version=v1.0 MSISSSLYPSPDDLPYEEELLRNPFSLKLWWRYLVARRQAPFKQREVIYERAVKALPGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G28740			Tetratricopeptide repeat (TPR)...		Lus10003867 [exp]	0	1
					Lus10030519 [exp]	3.3	0.6821
AT3G61150	HD	HD-GL2-1, HDG1	HOMEODOMAIN-GLABRA2 1, homeodo...		Lus10005758 [exp]	3.7	0.6774
AT5G50790		SWEET10, AtSWEE...	Nodulin MtN3 family protein (....		Lus10023249 [exp]	11.9	0.6467
AT2G02850		ARPN	plantacyanin (.1)		Lus10028396 [exp]	13.7	0.6467
					Lus10000351 [exp]	15.3	0.6467
AT5G50260		CEP1	cysteine endopeptidase 1, Cyst...		Lus10042691 [exp]	15.7	0.6120
					Lus10002886 [exp]	16.8	0.6467
AT5G58660			2-oxoglutarate (2OG) and Fe(II...		Lus10031865 [exp]	18.1	0.6467
AT5G02930			F-box/RNI-like superfamily pro...		Lus10032255 [exp]	19.4	0.6467
AT5G66870	AS2	LBD36, ASL1	LATERAL ORGAN BOUNDARIES DOMAI...		Lus10006679 [exp]	20.6	0.6467

Compare expression of checked genes

Lus10003867 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.