Lus10003874 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G54855 213 / 2e-72 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001821 266 / 2e-93 AT5G54855 219 / 1e-74 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10019622 232 / 1e-79 AT5G54855 207 / 8e-70 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10008615 39 / 0.0004 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G137100 221 / 1e-75 AT5G54855 238 / 3e-82 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0287 Transthyretin PF01190 Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence
>Lus10003874 pacid=23144327 polypeptide=Lus10003874 locus=Lus10003874.g ID=Lus10003874.BGIv1.0 annot-version=v1.0
ATGGCTGTTGTCCTTCTGGTGACCACCACCGGCGTTCAAGCTTGGACTGGTGAAATCCGCGGGAGAGTTGTTTGTGATGTGTGCGGCGATTCTTCTATGG
GACCTGAGGATCACGTTCTCGAAGGTGCTGAAGTGGCTGTTCTGTGCATAACAAAGTCAGGGGAAGTTGTCAACTACCAAGCATTTACAAATGCCAAAGG
AATCTACACCGTCGCGGAAACTATGCCGGAGAGTGACCGTTGGGATGCATGCCTGGCGAGACCAATAAGCAGCTTCCATGAACACTGCAGCCATCTGGGG
GCTAGTAGCAAAGGTGTGAAGTTCAGTTACAAAAAGCCATCTGGGTATTCCCACAGCGTCAGATCGTTTGTGTACCGGCATTCCAGCCCACCATCATACT
GCTTGTAG
AA sequence
>Lus10003874 pacid=23144327 polypeptide=Lus10003874 locus=Lus10003874.g ID=Lus10003874.BGIv1.0 annot-version=v1.0
MAVVLLVTTTGVQAWTGEIRGRVVCDVCGDSSMGPEDHVLEGAEVAVLCITKSGEVVNYQAFTNAKGIYTVAETMPESDRWDACLARPISSFHEHCSHLG
ASSKGVKFSYKKPSGYSHSVRSFVYRHSSPPSYCL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G54855 Pollen Ole e 1 allergen and ex... Lus10003874 0 1
AT2G47450 CPSRP43, CAO CHLOROPLAST SIGNAL RECOGNITION... Lus10025111 3.0 0.7308
AT4G26670 Mitochondrial import inner mem... Lus10032577 4.2 0.7523
AT2G27730 copper ion binding (.1) Lus10004865 10.8 0.7069
AT5G01650 Tautomerase/MIF superfamily pr... Lus10022681 11.0 0.7388
AT3G25580 Thioredoxin superfamily protei... Lus10026602 12.0 0.7283
AT5G52010 C2H2ZnF C2H2-like zinc finger protein ... Lus10024807 26.3 0.7092
AT1G31830 Amino acid permease family pro... Lus10007593 26.5 0.7156
AT3G11670 DGD1 DIGALACTOSYL DIACYLGLYCEROL DE... Lus10029404 27.0 0.6803
AT3G12260 LYR family of Fe/S cluster bio... Lus10008661 27.3 0.6629
AT1G75080 BZR BZR1 BRASSINAZOLE-RESISTANT 1, Bras... Lus10014326 28.2 0.7126

Lus10003874 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.