Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001828 [exp] 155 / 3e-50 ND 35 / 0.003 Lus10003883 [exp] 108 / 2e-31 ND / Lus10023083 [exp] 62 / 2e-13 ND 36 / 0.005 Lus10023082 [exp] 59 / 3e-12 ND / Lus10032385 [exp] 56 / 1e-10 ND 39 / 1e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G091500 [exp] 64 / 2e-14 AT1G64405 42 / 5e-06 unknown protein Potri.003G140100 [exp] 61 / 3e-13 AT1G64405 42 / 5e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003882 pacid=23144349 polypeptide=Lus10003882 locus=Lus10003882.g ID=Lus10003882.BGIv1.0 annot-version=v1.0 ATGGGGAATTGTTTAAGATCAAGCAAGCTAAGCAGCCAAGTGCACGATGAGGAACAACAACAACAACAACATGATGATCAGTTCAGCACTTGTCACCCAG AGCAACAACTGAAGAAGTCATCATCATCATCATCATCATCAGGGGATCACAATAGTCATGATGATGAAGGGACGAAAGTGAAGATAGTTTTGACGAAAGA AGAGCTGCAGTGGCTGATGCACGAGCTCAAAGTGAATAATAAAAAGCTTGAAGAAGCTCTGGCTGAGATCCAAAGAAGCAGAGCCTTGAAATCCGTTGTT ACTAACAACTGTTGGCGGCCTTCTTTGGAGAGTATTTCTGAAGACGACCTTGATGAATGA
AA sequence Show only first row Show all	>Lus10003882 pacid=23144349 polypeptide=Lus10003882 locus=Lus10003882.g ID=Lus10003882.BGIv1.0 annot-version=v1.0 MGNCLRSSKLSSQVHDEEQQQQQHDDQFSTCHPEQQLKKSSSSSSSSGDHNSHDDEGTKVKIVLTKEELQWLMHELKVNNKKLEEALAEIQRSRALKSVV TNNCWRPSLESISEDDLDE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10003882 [exp]	0	1
AT2G36870		XTH32	xyloglucan endotransglucosylas...		Lus10026535 [exp]	7.0	0.7279
AT5G14890			NHL domain-containing protein ...		Lus10001933 [exp]	10.5	0.6824
AT1G06530		PMD2	peroxisomal and mitochondrial ...		Lus10031394 [exp]	11.2	0.7263
AT1G08450		AtCRT3, PSL1, E...	PRIORITY IN SWEET LIFE 1, EMS-...		Lus10026849 [exp]	21.7	0.6934
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Lus10014277 [exp]	22.1	0.7118
AT1G11840		ATGLX1	glyoxalase I homolog (.1.2.3.4...		Lus10003523 [exp]	30.5	0.7145
AT4G26780		MGE2, AR192	mitochondrial GrpE 2, Co-chape...		Lus10043180 [exp]	30.9	0.6780
AT1G28600			GDSL-like Lipase/Acylhydrolase...		Lus10015477 [exp]	46.1	0.6585
AT4G10250		ATHSP22.0	HSP20-like chaperones superfam...		Lus10042408 [exp]	53.2	0.6626
AT5G37670		HSP15.7CI	HSP20-like chaperones superfam...		Lus10020815 [exp]	61.1	0.6758

Compare expression of checked genes

Lus10003882 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.