Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001828 [exp] 111 / 1e-32 ND 35 / 0.003 Lus10003882 [exp] 86 / 7e-23 ND 35 / 0.004 Lus10023083 [exp] 66 / 1e-14 ND 36 / 0.005 Lus10023082 [exp] 65 / 2e-14 ND / Lus10032385 [exp] 64 / 8e-14 ND 39 / 1e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G140100 [exp] 63 / 4e-14 AT1G64405 42 / 5e-06 unknown protein Potri.001G091500 [exp] 62 / 1e-13 AT1G64405 42 / 5e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003883 pacid=23144324 polypeptide=Lus10003883 locus=Lus10003883.g ID=Lus10003883.BGIv1.0 annot-version=v1.0 ATGGGGAATTGCTTACAACCAAGCAAGATAAGCAGCAAAGTACATGATGAAGTAGCACAACATCAGCTAGAAGTGAGCAATGATCATGTTAAGCAACAGC AAGAGTCGAAGTCATCAAGGGGCATTAATGTAAATGGCGAAACTGAAGAAGGGACGAAAGTGAAGATAGTTCTAACGAAAGGAGAGCTGGAGTGGCTGAT GATCGAGCTCAAAGTGAAGAATAAAAAGCTTGAAGAAGCTCTGGCTGAGATCCAGAGAAGCAGAGCCGCCTTGAAATCCATTAATATTGCTGGCAACAGC ACATGGCAGCCTTCTTTGGAGAGCATTTCTGAAGACGACCTTGATGAATCTGAGAGATAG
AA sequence Show only first row Show all	>Lus10003883 pacid=23144324 polypeptide=Lus10003883 locus=Lus10003883.g ID=Lus10003883.BGIv1.0 annot-version=v1.0 MGNCLQPSKISSKVHDEVAQHQLEVSNDHVKQQQESKSSRGINVNGETEEGTKVKIVLTKGELEWLMIELKVKNKKLEEALAEIQRSRAALKSINIAGNS TWQPSLESISEDDLDESER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10003883 [exp]	0	1
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10040731 [exp]	2.4	0.8259
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10016499 [exp]	4.2	0.8365
					Lus10034884 [exp]	5.5	0.8250
					Lus10039994 [exp]	10.6	0.7844
AT3G05410			Photosystem II reaction center...		Lus10029903 [exp]	13.9	0.8419
					Lus10029656 [exp]	25.1	0.7952
AT5G59200		OTP80	ORGANELLE TRANSCRIPT PROCESSIN...		Lus10005294 [exp]	28.9	0.7994
AT5G09660		PMDH2	peroxisomal NAD-malate dehydro...		Lus10020501 [exp]	31.2	0.8251
					Lus10032581 [exp]	33.3	0.7678
					Lus10011351 [exp]	33.8	0.7641

Compare expression of checked genes

Lus10003883 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.