Lus10003951 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47740 358 / 6e-126 PPPDE putative thiol peptidase family protein (.1.2)
AT4G17486 226 / 9e-75 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 224 / 1e-73 PPPDE putative thiol peptidase family protein (.1)
AT5G25170 223 / 2e-73 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 219 / 7e-72 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 216 / 2e-70 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 201 / 4e-60 unknown protein
AT4G25680 79 / 2e-17 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 78 / 5e-17 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 56 / 3e-09 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032708 490 / 2e-178 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040485 286 / 4e-98 AT1G47740 272 / 6e-92 PPPDE putative thiol peptidase family protein (.1.2)
Lus10011291 283 / 6e-97 AT1G47740 270 / 3e-91 PPPDE putative thiol peptidase family protein (.1.2)
Lus10018326 229 / 4e-76 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10005341 226 / 8e-75 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Lus10017127 225 / 1e-74 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10039492 221 / 3e-73 AT1G47740 213 / 2e-69 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040170 221 / 8e-73 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Lus10041021 221 / 1e-72 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G134200 398 / 3e-142 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.014G042300 394 / 1e-140 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 340 / 2e-119 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 339 / 6e-119 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 331 / 7e-116 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.003G080300 234 / 1e-77 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.001G154400 227 / 8e-75 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.006G261500 226 / 1e-74 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 226 / 2e-74 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.003G180400 221 / 1e-72 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10003951 pacid=23144778 polypeptide=Lus10003951 locus=Lus10003951.g ID=Lus10003951.BGIv1.0 annot-version=v1.0
ATGAAACTGGGGTCGAAGAAAGGATGGAAATCAATGATGCCCCTTAGGCTGAGGAGTAAAACAGGTACAGCTACACGTTTTTGTTTGTTCCCAAAACAAA
GGACAGTTGGGTATGGTCCAGACAAAGCACCAGTCTATCTCAATGTCTATGACTTGACACCCATGAATGGCTATGTCTATTGGGCTGGTCTTGGCATCTT
TCACTCCGGTGTCCAAGTTCATGGGGTAGAGTATGCATTCGGAGCGCATGACTATCCGACGAGTGGCGTATTCGAGGTTGAGCCAAGGCAGTGTCCTGGC
TTTAAGTTCAGAAGGTCTGTATTTGTTGGAACCACGTCCATGGATCCCAATCAGGTTAGGGAGTTTATGAAGCAGCACGCAGCGAGCTACCATGGCGATA
CCTACCACTTGATTGTTAAGAATTGCAATCATTTCTGCAAGGACGTTTGTCACAAGCTGACGGGTAGACCCATTCCAAAATGGGTGAATCGACTAGCACA
AATAGGATCGGTATGCAACTGCATACTTCCGGAGTCTCTGAAGATAACAGCGGATCCAAATGGAGAAGCATGCGACAACGAAAAGACAAGGCTGAGAGGT
GCATTCAGTTGCTTGTCTTCAATCTCTATGAGACAGAAGCAGCTATCGACGTCTTCATTAATCCTACAGTCTCCATTGAAAGGTTGCTTACCGTGGGAAT
TGAAGAGGTCAATCAGCAGTTTGCTCAAGGAGAGATGA
AA sequence
>Lus10003951 pacid=23144778 polypeptide=Lus10003951 locus=Lus10003951.g ID=Lus10003951.BGIv1.0 annot-version=v1.0
MKLGSKKGWKSMMPLRLRSKTGTATRFCLFPKQRTVGYGPDKAPVYLNVYDLTPMNGYVYWAGLGIFHSGVQVHGVEYAFGAHDYPTSGVFEVEPRQCPG
FKFRRSVFVGTTSMDPNQVREFMKQHAASYHGDTYHLIVKNCNHFCKDVCHKLTGRPIPKWVNRLAQIGSVCNCILPESLKITADPNGEACDNEKTRLRG
AFSCLSSISMRQKQLSTSSLILQSPLKGCLPWELKRSISSLLKER

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47740 PPPDE putative thiol peptidase... Lus10003951 0 1
AT2G45250 Integral membrane protein hemo... Lus10003319 2.0 0.8811
AT1G47740 PPPDE putative thiol peptidase... Lus10032708 2.0 0.8759
AT3G29290 EMB2076 embryo defective 2076, Pentatr... Lus10018198 4.9 0.8562
AT2G34560 P-loop containing nucleoside t... Lus10038499 5.0 0.8659
AT4G30845 unknown protein Lus10026098 5.3 0.8884
AT3G13510 Protein of Unknown Function (D... Lus10010315 10.4 0.8333
AT3G07360 ATPUB9 ARABIDOPSIS THALIANA PLANT U-B... Lus10020413 14.7 0.8401
AT3G20390 endoribonuclease L-PSP family ... Lus10021523 19.3 0.8526
AT4G33670 NAD(P)-linked oxidoreductase s... Lus10012456 21.8 0.8389
AT4G15510 Photosystem II reaction center... Lus10000614 22.1 0.8774

Lus10003951 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.