Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02120 122 / 2e-37 PDE335, OHP PIGMENT DEFECTIVE 335, one helix protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023782 [exp] 201 / 1e-68 AT5G02120 121 / 8e-37 PIGMENT DEFECTIVE 335, one helix protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G088200 [exp] 142 / 3e-45 AT5G02120 119 / 7e-36 PIGMENT DEFECTIVE 335, one helix protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003965 pacid=23157469 polypeptide=Lus10003965 locus=Lus10003965.g ID=Lus10003965.BGIv1.0 annot-version=v1.0 ATGGCTTCTTCCATATCATCCCCATCCCTTCTCCCCAGTAAAGCTCTCACCTGCAACCGCTCAAGTCGCAAGCTCTTGCTTCCTCCTTTCAACTGTCAGA GGACCAGAACCTCACAGAAGCAACTCTCTTTCACAGTCCAAGCTGCCAGGCTCCCTGCTGGTGTGGAGTTGCCAAAAGTTGAGCCGAAATTCAAAGCCCC GTTCCTTGGATTCACCAGGACTGCTGAAATATGGAATTCCCGTGCTTGCATGATTGGCCTCATTGGAACTTTCTTTGTCGAATTGATAATAAACAAAGGC ATACTTCAAGTGATTGGAGTTGAAATTGGGAAGGGGCTGGATCTTCCTCTCTGA
AA sequence Show only first row Show all	>Lus10003965 pacid=23157469 polypeptide=Lus10003965 locus=Lus10003965.g ID=Lus10003965.BGIv1.0 annot-version=v1.0 MASSISSPSLLPSKALTCNRSSRKLLLPPFNCQRTRTSQKQLSFTVQAARLPAGVELPKVEPKFKAPFLGFTRTAEIWNSRACMIGLIGTFFVELIINKG ILQVIGVEIGKGLDLPL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02120		PDE335, OHP	PIGMENT DEFECTIVE 335, one hel...		Lus10003965 [exp]	0	1
AT3G61870			unknown protein		Lus10010112 [exp]	2.0	0.9569
AT1G55670		PSAG	photosystem I subunit G (.1)		Lus10017476 [exp]	3.5	0.9552
AT5G19940			Plastid-lipid associated prote...		Lus10026221 [exp]	3.5	0.9511
AT1G55670		PSAG	photosystem I subunit G (.1)		Lus10028806 [exp]	5.7	0.9498
AT1G03130		PSAD-2	photosystem I subunit D-2 (.1)		Lus10041209 [exp]	6.5	0.9407
AT1G60950		FED A, ATFD2, F...	FERREDOXIN 2, 2Fe-2S ferredoxi...		Lus10001369 [exp]	7.3	0.9360
AT2G06520		PSBX	photosystem II subunit X (.1)		Lus10033434 [exp]	7.4	0.9454
AT4G22890		PGR5-LIKEA, PGR...	PGR5-LIKE A (.1.2.3.4.5)		Lus10006710 [exp]	8.5	0.9448
AT1G73060		LPA3	Low PSII Accumulation 3 (.1)		Lus10026089 [exp]	8.9	0.9348
AT5G02120		PDE335, OHP	PIGMENT DEFECTIVE 335, one hel...		Lus10023782 [exp]	9.2	0.9308

Compare expression of checked genes

Lus10003965 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.