Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G46060 246 / 6e-84 ARA3, Ara-3, AtRABE1c, AtRab8A RAB GTPase homolog 8A (.1.2.3) AT5G59840 243 / 1e-82 Ras-related small GTP-binding family protein (.1) AT5G03520 243 / 2e-82 ATRAB-E1D, AtRab8C, AtRABE1d ARABIDOPSIS RAB HOMOLOG E1D, RAB GTPase homolog 8C (.1.2) AT3G53610 240 / 2e-81 ATRAB8, AtRab8B, AtRABE1a RAB GTPase homolog 8 (.1.2.3) AT3G09900 238 / 8e-81 AtRABE1e, AtRab8E RAB GTPase homolog E1E (.1) AT1G02130 176 / 3e-56 ARA5, AtRABD2a, AtRab1B, Ara-5 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) AT4G17530 165 / 4e-52 RAB1C, AtRab1C, AtRABD2c RAB GTPase homolog 1C (.1) AT3G11730 164 / 7e-52 ATFP8, AtRABD1 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG D1, Ras-related small GTP-binding family protein (.1) AT5G47200 164 / 9e-52 AtRABD2b, AtRab1A ARABIDOPSIS RAB GTPASE HOMOLOG D2B, RAB GTPase homolog 1A (.1) AT4G17160 135 / 1e-40 AtRab2B, AtRABB1a RAB GTPase homolog B1A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007698 [exp] 255 / 9e-88 AT3G46060 378 / 1e-135 RAB GTPase homolog 8A (.1.2.3) Lus10025309 [exp] 250 / 1e-85 AT3G46060 374 / 1e-133 RAB GTPase homolog 8A (.1.2.3) Lus10024423 [exp] 245 / 8e-84 AT3G46060 376 / 7e-135 RAB GTPase homolog 8A (.1.2.3) Lus10005890 [exp] 246 / 1e-83 AT3G46060 396 / 2e-142 RAB GTPase homolog 8A (.1.2.3) Lus10040856 [exp] 243 / 6e-83 AT3G46060 366 / 7e-131 RAB GTPase homolog 8A (.1.2.3) Lus10023430 [exp] 241 / 1e-81 AT3G46060 364 / 3e-129 RAB GTPase homolog 8A (.1.2.3) Lus10005443 [exp] 239 / 2e-81 AT3G46060 394 / 2e-141 RAB GTPase homolog 8A (.1.2.3) Lus10004944 [exp] 237 / 2e-80 AT3G46060 348 / 1e-123 RAB GTPase homolog 8A (.1.2.3) Lus10000595 [exp] 168 / 2e-53 AT5G47200 387 / 3e-139 ARABIDOPSIS RAB GTPASE HOMOLOG D2B, RAB GTPase homolog 1A (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G236100 [exp] 245 / 1e-83 AT5G59840 333 / 1e-117 Ras-related small GTP-binding family protein (.1) Potri.008G051700 [exp] 245 / 1e-83 AT3G46060 329 / 7e-116 RAB GTPase homolog 8A (.1.2.3) Potri.010G208900 [exp] 244 / 4e-83 AT3G46060 349 / 5e-124 RAB GTPase homolog 8A (.1.2.3) Potri.009G027900 [exp] 243 / 6e-83 AT3G46060 341 / 8e-121 RAB GTPase homolog 8A (.1.2.3) Potri.014G049400 [exp] 168 / 2e-53 AT1G02130 390 / 2e-140 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.002G138400 [exp] 166 / 9e-53 AT1G02130 393 / 1e-141 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.001G080400 [exp] 165 / 5e-52 AT1G02130 387 / 2e-139 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.003G081800 [exp] 164 / 7e-52 AT1G02130 391 / 9e-141 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.001G152800 [exp] 163 / 2e-51 AT1G02130 382 / 2e-137 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.004G226600 [exp] 162 / 3e-51 AT3G11730 364 / 4e-130 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG D1, Ras-related small GTP-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10003984 pacid=23157461 polypeptide=Lus10003984 locus=Lus10003984.g ID=Lus10003984.BGIv1.0 annot-version=v1.0 ATGGATTTGAAGCTTGCATCAAGTGTGGGTAAGAGTTGCCTCCTCCTACGTTTCTCAGATGGTTCCTTCACCACTAGTTTCATTACGACCATTGGTATTG ATTTCAAGATAAGGACAATTGAGCTTGATGGAAAACGGATCAAGTTGCAAATATGGGATACTGCTGGTCAAGAGCGTTTCCGCACTATTACAACTGCTTA CTATCGTGGAGCAATGGGTATTTTGCTCGTGTATGATGTCACTGATGAGTCATCATTCAACAATATCAGGAATTGGATTCGCAACATTGAACAACATGCC TCTGATAATGTGAACAAGATCTTGGTTGGAAACAAAGCCGATATGGATGAGAGCAAAAGGGCGGTTCCTACCGCAAAGGGCCAGGCTCTTGCAGACGAAT ACGGCATCAAGTTCTTTGAGACGAGTGCAAAGACAAACTTAATGGGATTGACTTCCGTCTCAGAATCCGAAATCCTAAACGAAGACGGAGCTCCATTCTG A
AA sequence Show only first row Show all	>Lus10003984 pacid=23157461 polypeptide=Lus10003984 locus=Lus10003984.g ID=Lus10003984.BGIv1.0 annot-version=v1.0 MDLKLASSVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHA SDNVNKILVGNKADMDESKRAVPTAKGQALADEYGIKFFETSAKTNLMGLTSVSESEILNEDGAPF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G46060		ARA3, Ara-3, At...	RAB GTPase homolog 8A (.1.2.3)		Lus10003984 [exp]	0	1
AT5G53560		B5#2, ATB5-A, A...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10008838 [exp]	12.7	0.8993
AT1G63830			PLAC8 family protein (.1.2.3)		Lus10017509 [exp]	15.9	0.8981
AT2G16250			Leucine-rich repeat protein ki...		Lus10040455 [exp]	21.3	0.8869
AT2G01140		PDE345	PIGMENT DEFECTIVE 345, Aldolas...		Lus10034619 [exp]	25.4	0.8937
AT4G26750		EXT-like	extensin-like, hydroxyproline-...		Lus10033994 [exp]	28.3	0.8569
AT3G24550		ATPERK1	proline-rich extensin-like rec...		Lus10011098 [exp]	30.4	0.8728
AT3G09560		ATPAH1	PHOSPHATIDIC ACID PHOSPHOHYDRO...		Lus10025284 [exp]	34.9	0.8611
AT1G78310			VQ motif-containing protein (....		Lus10010348 [exp]	36.8	0.8669
AT5G08300			Succinyl-CoA ligase, alpha sub...		Lus10010187 [exp]	37.5	0.8625
AT1G21380			Target of Myb protein 1 (.1)		Lus10029739 [exp]	38.5	0.8784

Compare expression of checked genes

Lus10003984 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.