Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53610 104 / 1e-29 ATRAB8, AtRab8B, AtRABE1a RAB GTPase homolog 8 (.1.2.3) AT5G59840 102 / 4e-29 Ras-related small GTP-binding family protein (.1) AT3G46060 100 / 3e-28 ARA3, Ara-3, AtRABE1c, AtRab8A RAB GTPase homolog 8A (.1.2.3) AT5G03520 76 / 5e-19 ATRAB-E1D, AtRab8C, AtRABE1d ARABIDOPSIS RAB HOMOLOG E1D, RAB GTPase homolog 8C (.1.2) AT3G09900 68 / 1e-15 AtRABE1e, AtRab8E RAB GTPase homolog E1E (.1) AT4G17160 37 / 0.0003 AtRab2B, AtRABB1a RAB GTPase homolog B1A (.1) AT4G17170 37 / 0.0004 ATRAB-B1B, AT-RAB2, AtRABB1c, AtRab2A ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007698 [exp] 122 / 1e-36 AT3G46060 378 / 1e-135 RAB GTPase homolog 8A (.1.2.3) Lus10024423 [exp] 118 / 2e-35 AT3G46060 376 / 7e-135 RAB GTPase homolog 8A (.1.2.3) Lus10025309 [exp] 118 / 4e-35 AT3G46060 374 / 1e-133 RAB GTPase homolog 8A (.1.2.3) Lus10040856 [exp] 99 / 1e-27 AT3G46060 366 / 7e-131 RAB GTPase homolog 8A (.1.2.3) Lus10004944 [exp] 99 / 2e-27 AT3G46060 348 / 1e-123 RAB GTPase homolog 8A (.1.2.3) Lus10005443 [exp] 98 / 3e-27 AT3G46060 394 / 2e-141 RAB GTPase homolog 8A (.1.2.3) Lus10023430 [exp] 99 / 4e-27 AT3G46060 364 / 3e-129 RAB GTPase homolog 8A (.1.2.3) Lus10005890 [exp] 97 / 1e-26 AT3G46060 396 / 2e-142 RAB GTPase homolog 8A (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G208900 [exp] 105 / 4e-30 AT3G46060 349 / 5e-124 RAB GTPase homolog 8A (.1.2.3) Potri.008G051700 [exp] 102 / 6e-29 AT3G46060 329 / 7e-116 RAB GTPase homolog 8A (.1.2.3) Potri.009G027900 [exp] 87 / 5e-23 AT3G46060 341 / 8e-121 RAB GTPase homolog 8A (.1.2.3) Potri.001G236100 [exp] 82 / 4e-21 AT5G59840 333 / 1e-117 Ras-related small GTP-binding family protein (.1) Potri.016G002200 [exp] 37 / 0.0002 AT4G17170 394 / 6e-142 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10003985 pacid=23157462 polypeptide=Lus10003985 locus=Lus10003985.g ID=Lus10003985.BGIv1.0 annot-version=v1.0 ATGGCATCAAGTTCTTTGAGACTTTGTTATATCATGCAGAGTGCAAAGACAAACTTAAACGTGGAGGAGGTTTTCTTCTCAATAGCCAGAGACATCAAGC AACGACTTGCAGATACGGATTCAAAGTCCGAGCCACAGACGATCAAGATTAACCAGCCGGACCAGGCGGGTGGTTCGAACCAGGCTGCACAAAAGTCTGC TTGCTGTGGTTCTTAG
AA sequence Show only first row Show all	>Lus10003985 pacid=23157462 polypeptide=Lus10003985 locus=Lus10003985.g ID=Lus10003985.BGIv1.0 annot-version=v1.0 MASSSLRLCYIMQSAKTNLNVEEVFFSIARDIKQRLADTDSKSEPQTIKINQPDQAGGSNQAAQKSACCGS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53610		ATRAB8, AtRab8B...	RAB GTPase homolog 8 (.1.2.3)		Lus10003985 [exp]	0	1
AT3G10960		ATAZG1	AZA-guanine resistant1 (.1)		Lus10012895 [exp]	25.5	0.7793
AT4G35630		PSAT	phosphoserine aminotransferase...		Lus10039587 [exp]	29.9	0.8142
AT3G47670			Plant invertase/pectin methyle...		Lus10008625 [exp]	38.6	0.8128
AT1G18390			Protein kinase superfamily pro...		Lus10022432 [exp]	39.6	0.8061
AT1G26270			Phosphatidylinositol 3- and 4-...		Lus10000012 [exp]	53.4	0.7922
AT4G29120			6-phosphogluconate dehydrogena...		Lus10034977 [exp]	61.9	0.7961
AT5G22060		ATJ2	ARABIDOPSIS THALIANA DNAJ HOMO...		Lus10002733 [exp]	73.6	0.7879
AT3G22110		PAC1	20S proteasome alpha subunit C...		Lus10004236 [exp]	81.1	0.7829
AT2G32720		B5 #4, B5#4, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10022794 [exp]	81.3	0.7718
AT3G21220		ATMAP2K_ALPHA, ...	ARABIDOPSIS THALIANA MITOGEN-A...		Lus10037340 [exp]	90.1	0.7456

Compare expression of checked genes

Lus10003985 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.