Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01310 138 / 3e-39 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G09590 134 / 2e-38 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25780 133 / 6e-38 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G02730 127 / 3e-35 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 123 / 3e-34 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G30320 122 / 4e-34 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 120 / 7e-33 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 119 / 5e-32 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 116 / 1e-31 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 111 / 6e-30 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009068 [exp] 220 / 2e-71 AT3G09590 149 / 1e-45 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10025279 [exp] 219 / 3e-71 AT3G09590 144 / 7e-44 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10015044 [exp] 202 / 3e-65 AT1G01310 77 / 8e-18 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10001319 [exp] 139 / 2e-40 AT4G30320 201 / 6e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006980 [exp] 137 / 1e-39 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10019993 [exp] 128 / 8e-36 AT4G30320 197 / 7e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10011318 [exp] 127 / 2e-35 AT4G31470 164 / 1e-51 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006981 [exp] 127 / 2e-35 AT4G25780 235 / 2e-79 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10015522 [exp] 124 / 2e-34 AT4G30320 199 / 7e-66 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G082000 [exp] 158 / 8e-47 AT3G09590 137 / 2e-40 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G215600 [exp] 143 / 4e-41 AT3G09590 132 / 1e-38 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096007 [exp] 139 / 1e-40 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G171300 [exp] 136 / 2e-39 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096028 [exp] 129 / 2e-35 AT4G25780 219 / 3e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083000 [exp] 119 / 9e-33 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083100 [exp] 117 / 6e-32 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 117 / 6e-32 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.018G007000 [exp] 117 / 1e-31 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083600 [exp] 108 / 8e-29 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10003990 pacid=23157472 polypeptide=Lus10003990 locus=Lus10003990.g ID=Lus10003990.BGIv1.0 annot-version=v1.0 ATGACGTCGGCGAGTAGTACTCCCTTAATCCTTGTCCTGATCATTCTCGCCGTCACCACCGCTGCATCCGCCACCTCCCATTCCAAATCAACCACTCCAC CACCGCATCCTCACGCCAAACCCCCCTCCTCGAAATCAACCAGTACTCCAATTCCACCGCCTCCCCACCAACAATCCTCCTCCTCCTCGGCCAAATCAAC CAGCAAATCAATTCCACCTCCACCGCCTCCCAGGGACCAATCCTCTGCTGGCGCCGGAATCATCGACCCCAACCACGCGGTATACAATGGAGAAGGACTA GCCTCCCAATTCCTGTACGCACACAACAAGATCAGGGCGATGTACTACCTACCGGCCTTGAAATGGAACAGGACTCTAGCCCGATTCGCCAGACACTACG CCAACAGCAGGATGAAGGACTGCCTGCTCCAGCACTCGAATGACCGGATCTACGGGGAGAACATGTTTTGGAGCAAGTACGGGCACTGGACCCCGTCCAA CGTGGTGAAGACATGGGCAGACGAGATGAAGTTCTACGATTTCCGGTCCAACCAGTGCATGCAGAGCCAGCCGTGCGGGCATTTCACGCAGATAATATGG AAGTCGACCACCCAGGTGGGTTGCGGGAGAGTGCAGTGCCTTAACAATAAGGGATTTCTCTACGTGTGTTCTTATGATCCCCCCGGTGCTTACTCTGTAG CATCGGGTTACCGACTAAGTCACCGACTTCATTTGGCTAATTGGGTAATCAAAGAAGGACCTCAGCTTGTTGATTCTGCTGTGTGGGCTGCTACTTGGGC TCTTCCGATTCCTCGAATTTTACAATTGAATCGGGTTGTTAGAACTTCATTCAATCTGATATACATCCAGCTGCATTCTGGAGGCGGTTCTGCTTTGAAG ATAAGGCTGCGGCAGAGAAGTTGGTGTTCTTTTGGTGGGGGCTTTGGAAATTGA
AA sequence Show only first row Show all	>Lus10003990 pacid=23157472 polypeptide=Lus10003990 locus=Lus10003990.g ID=Lus10003990.BGIv1.0 annot-version=v1.0 MTSASSTPLILVLIILAVTTAASATSHSKSTTPPPHPHAKPPSSKSTSTPIPPPPHQQSSSSSAKSTSKSIPPPPPPRDQSSAGAGIIDPNHAVYNGEGL ASQFLYAHNKIRAMYYLPALKWNRTLARFARHYANSRMKDCLLQHSNDRIYGENMFWSKYGHWTPSNVVKTWADEMKFYDFRSNQCMQSQPCGHFTQIIW KSTTQVGCGRVQCLNNKGFLYVCSYDPPGAYSVASGYRLSHRLHLANWVIKEGPQLVDSAVWAATWALPIPRILQLNRVVRTSFNLIYIQLHSGGGSALK IRLRQRSWCSFGGGFGN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01310			CAP (Cysteine-rich secretory p...		Lus10003990 [exp]	0	1
					Lus10024103 [exp]	3.5	0.8208
AT1G09815		POLD4	polymerase delta 4 (.1)		Lus10024978 [exp]	4.7	0.8087
AT4G02590	bHLH	bHLH059, UNE12	unfertilized embryo sac 12, ba...		Lus10014726 [exp]	12.8	0.7297
AT5G55590		QRT1	QUARTET 1, Pectin lyase-like s...		Lus10016605 [exp]	14.7	0.7596
AT4G08910			unknown protein		Lus10025524 [exp]	15.1	0.7587
AT5G44440			FAD-binding Berberine family p...		Lus10003646 [exp]	15.2	0.7401
AT3G04690		ANX1	ANXUR1, Malectin/receptor-like...		Lus10016907 [exp]	17.9	0.7120
					Lus10007244 [exp]	19.0	0.7438
AT3G07020		UGT80A2, SGT	UDP-glucosyl transferase 80A2,...		Lus10020381 [exp]	19.1	0.7301
					Lus10035120 [exp]	19.2	0.7507

Compare expression of checked genes

Lus10003990 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.