Lus10003995 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02800 295 / 1e-100 CDL1 CDG1-like 1, Protein kinase superfamily protein (.1)
AT5G13160 285 / 1e-95 PBS1 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
AT5G18610 278 / 3e-92 Protein kinase superfamily protein (.1.2)
AT2G28590 273 / 2e-91 Protein kinase superfamily protein (.1)
AT1G07870 272 / 4e-91 Protein kinase superfamily protein (.1.2)
AT3G20530 266 / 4e-89 Protein kinase superfamily protein (.1)
AT3G24790 238 / 2e-78 Protein kinase superfamily protein (.1)
AT3G07070 239 / 4e-78 Protein kinase superfamily protein (.1)
AT1G20650 237 / 7e-78 ASG5 ALTERED SEED GERMINATION 5, Protein kinase superfamily protein (.1)
AT1G61860 236 / 2e-77 Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014019 330 / 3e-113 AT5G02800 532 / 0.0 CDG1-like 1, Protein kinase superfamily protein (.1)
Lus10019897 326 / 7e-113 AT5G02800 533 / 0.0 CDG1-like 1, Protein kinase superfamily protein (.1)
Lus10036499 302 / 4e-103 AT5G18610 575 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10041426 300 / 3e-102 AT5G18610 582 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10040350 295 / 2e-100 AT5G18610 569 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10023473 295 / 2e-100 AT5G18610 568 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10012814 282 / 5e-94 AT5G18610 807 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10033966 282 / 5e-94 AT5G18610 805 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10015756 275 / 1e-91 AT5G13160 732 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G133300 305 / 5e-104 AT5G02800 566 / 0.0 CDG1-like 1, Protein kinase superfamily protein (.1)
Potri.008G046500 301 / 5e-103 AT5G18610 582 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.010G215100 298 / 6e-102 AT5G18610 595 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.009G026500 282 / 3e-95 AT1G07870 595 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.010G021500 284 / 1e-94 AT5G18610 779 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.001G234100 278 / 9e-94 AT1G07870 590 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.001G060800 279 / 2e-93 AT5G13160 714 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Potri.003G166900 279 / 3e-93 AT5G13160 745 / 0.0 avrPphB susceptible 1, Protein kinase superfamily protein (.1)
Potri.008G205700 279 / 9e-93 AT5G18610 783 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.001G421400 266 / 3e-89 AT3G20530 587 / 0.0 Protein kinase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10003995 pacid=23157485 polypeptide=Lus10003995 locus=Lus10003995.g ID=Lus10003995.BGIv1.0 annot-version=v1.0
ATGAAAATCGCGGCAGGAGCAGCGAAAGGACTCGAGCATTTGCATGACAATGTAAAGCCTCCTGTCATCTACAGAGATCTTAAATGCTCAAACATTTTAC
TCGACAGAGGATACCATCCCAAGTTATCCGATTTCGGGTTGGCTAAACTCGGCCCTGTGGGTGACAACACCCATGTGTCCACAAGAGTTATGGGTACATT
CGGGTATTGTGCTCCTGAATACGCAATGACTGCCCAATTGACCTTGAAATCAGATGTTTACAGCTTCAGGGTTGTGTTGTTGGACATCATTCCTGGAAGG
AGAGCATTCGACACCTGCAAACCGGCAGCCGAGCAGAATCTGGTAGCTTGGGCAAGGTCGATGTTCAACGATCGGAGGAAATTGACAGAAATGGCTGATC
CGGTGATGGGTGGACGGTTTCCTGCGAGGGCAATGTACCAAGCTTTAGCGGTTGCAGGAATGTGCGTTCAGGAACAGCCTCACATGAGGCCTGCAATGGC
TGATGTTGTCACTGCTTTGTCTCACTTAGCTTCACAGAAGAGTGCAACTGAGAGGTAG
AA sequence
>Lus10003995 pacid=23157485 polypeptide=Lus10003995 locus=Lus10003995.g ID=Lus10003995.BGIv1.0 annot-version=v1.0
MKIAAGAAKGLEHLHDNVKPPVIYRDLKCSNILLDRGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTFGYCAPEYAMTAQLTLKSDVYSFRVVLLDIIPGR
RAFDTCKPAAEQNLVAWARSMFNDRRKLTEMADPVMGGRFPARAMYQALAVAGMCVQEQPHMRPAMADVVTALSHLASQKSATER

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G02800 CDL1 CDG1-like 1, Protein kinase su... Lus10003995 0 1
AT5G18610 Protein kinase superfamily pro... Lus10015051 6.0 0.6682
AT5G02800 CDL1 CDG1-like 1, Protein kinase su... Lus10015050 6.0 0.6546
AT4G03550 ATGSL5, PMR4, G... POWDERY MILDEW RESISTANT 4, gl... Lus10030030 11.0 0.6391
AT1G15520 ATABCG40, ABCG4... Arabidopsis thaliana ATP-bindi... Lus10041680 22.2 0.5996
Lus10029490 25.7 0.6292
AT3G23250 MYB ATMYB15, ATY19 myb domain protein 15 (.1.2) Lus10021185 26.6 0.6609
AT5G49150 GEX2, ATGEX2 gamete expressed 2 (.1) Lus10027014 28.6 0.5936
AT5G36930 Disease resistance protein (TI... Lus10042714 37.7 0.6273
AT5G03795 Exostosin family protein (.1) Lus10039142 39.2 0.6152
AT5G03910 ABCB29, ATATH12 ARABIDOPSIS THALIANA ABC TRANS... Lus10017024 52.6 0.5621

Lus10003995 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.