Lus10004003 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G25970 165 / 4e-48 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G02010 116 / 9e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G13600 110 / 8e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G02750 110 / 1e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G13880 109 / 2e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G24000 107 / 2e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G68930 105 / 8e-27 pentatricopeptide (PPR) repeat-containing protein (.1)
AT3G15130 103 / 5e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G25360 102 / 5e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G28690 102 / 9e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030249 303 / 2e-100 AT3G25970 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10033713 110 / 1e-28 AT1G03540 726 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10028953 109 / 3e-28 AT5G47460 541 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10035164 108 / 8e-28 AT3G02010 962 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10032091 107 / 2e-27 AT3G02330 925 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013540 105 / 1e-26 AT4G02750 1075 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014594 105 / 1e-26 AT3G02330 901 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10031994 105 / 1e-26 AT3G02010 957 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10028106 103 / 4e-26 AT1G25360 916 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G146800 207 / 1e-63 AT3G25970 805 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G001050 158 / 2e-50 AT3G25970 155 / 5e-45 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G136200 111 / 4e-29 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.005G187800 111 / 5e-29 AT3G09040 1201 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G048800 110 / 1e-28 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G058900 107 / 1e-27 AT4G13650 1282 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G111300 107 / 1e-27 AT3G02330 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G191000 105 / 1e-26 AT1G11290 1178 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.015G018700 102 / 6e-26 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G001200 102 / 1e-25 AT3G24000 798 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10004003 pacid=23153356 polypeptide=Lus10004003 locus=Lus10004003.g ID=Lus10004003.BGIv1.0 annot-version=v1.0
ATGCCTCAAAGAGACTCTGTCACTTGGAATACTATGATCACCGGGTATGTGAATTTGGGAAACTTGGAAACTGCTTGGGAGGTTCAAATTTCCAAAGCAA
GATGTGGGTTCTATCTGGATTTGTACAGCTTCGGCAGCTTGCTAAAGGGTGCTGCTCTTGCTCGCCGGATCGAATCCGGTCAGCAACTGCACTGCCAGAT
TGTTAAGATGGGTTTCGACGAGAGTGTTTATGCAGGGAGCGCGCTCCTCGACATGTATGCCAAGTGCGGGAGTGTCAATGATGCTCTTACTGTGTTCGAG
GACATGCCTCAACACAATTCGGTATCGTGGAACGCTCTCATTTCTGGGTTTGTGAAGGTTTGTGATAGAGATTCTGCATTTTGGTTGTTTGATTGTATGG
AGAAGGAAGGTGTAGACCCTGATGATGGATCATTGTCTCCTCTTCTGACGTTACTTGATGATGAAAGTTCTGTAGCTTAA
AA sequence
>Lus10004003 pacid=23153356 polypeptide=Lus10004003 locus=Lus10004003.g ID=Lus10004003.BGIv1.0 annot-version=v1.0
MPQRDSVTWNTMITGYVNLGNLETAWEVQISKARCGFYLDLYSFGSLLKGAALARRIESGQQLHCQIVKMGFDESVYAGSALLDMYAKCGSVNDALTVFE
DMPQHNSVSWNALISGFVKVCDRDSAFWLFDCMEKEGVDPDDGSLSPLLTLLDDESSVA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G25970 Pentatricopeptide repeat (PPR)... Lus10004003 0 1
AT1G71930 NAC VND7, ANAC030 Arabidopsis NAC domain contain... Lus10033281 6.1 0.8194
AT3G01460 MBD9, ATMBD9 methyl-CPG-binding domain 9 (.... Lus10030865 10.2 0.7931
AT4G14050 Pentatricopeptide repeat (PPR)... Lus10040634 11.4 0.7898
AT3G25970 Pentatricopeptide repeat (PPR)... Lus10004002 12.0 0.7733
AT1G68470 Exostosin family protein (.1) Lus10005566 15.9 0.7947
AT4G21190 EMB1417 embryo defective 1417, Pentatr... Lus10027533 22.2 0.8132
AT5G27110 Tetratricopeptide repeat (TPR)... Lus10036029 22.4 0.7835
AT1G64790 ILA ILITYHIA (.1.2) Lus10003747 24.1 0.7763
AT1G64310 Tetratricopeptide repeat (TPR)... Lus10028074 25.6 0.7844
AT4G14850 MEF11, LOI1 lovastatin insensitive 1, Pent... Lus10006123 26.1 0.7555

Lus10004003 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.