Lus10004014 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1)
AT2G28085 70 / 4e-16 SAUR-like auxin-responsive protein family (.1)
AT2G46690 59 / 4e-12 SAUR-like auxin-responsive protein family (.1)
AT1G19840 58 / 2e-11 SAUR-like auxin-responsive protein family (.1)
AT4G00880 57 / 4e-11 SAUR-like auxin-responsive protein family (.1)
AT2G37030 56 / 5e-11 SAUR-like auxin-responsive protein family (.1)
AT1G75590 56 / 1e-10 SAUR-like auxin-responsive protein family (.1)
AT4G38860 55 / 1e-10 SAUR-like auxin-responsive protein family (.1)
AT1G56150 54 / 4e-10 SAUR-like auxin-responsive protein family (.1)
AT5G10990 54 / 5e-10 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030263 263 / 4e-92 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1)
Lus10013819 214 / 4e-73 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Lus10026531 213 / 1e-72 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1)
Lus10023012 150 / 1e-47 AT3G09870 97 / 5e-27 SAUR-like auxin-responsive protein family (.1)
Lus10001398 150 / 2e-47 AT3G09870 97 / 9e-27 SAUR-like auxin-responsive protein family (.1)
Lus10001397 82 / 6e-21 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Lus10026532 77 / 8e-19 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
Lus10016129 76 / 4e-18 AT2G28085 115 / 4e-34 SAUR-like auxin-responsive protein family (.1)
Lus10016130 75 / 8e-18 AT2G28085 111 / 2e-32 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G092400 150 / 9e-48 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1)
Potri.006G125100 147 / 7e-47 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.010G226400 82 / 7e-21 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 63 / 1e-13 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.014G103300 61 / 1e-12 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 61 / 1e-12 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
Potri.002G176400 60 / 2e-12 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1)
Potri.004G164300 58 / 2e-11 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1)
Potri.005G237000 57 / 5e-11 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Potri.009G125900 57 / 6e-11 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10004014 pacid=23153342 polypeptide=Lus10004014 locus=Lus10004014.g ID=Lus10004014.BGIv1.0 annot-version=v1.0
ATGTCTAGCAATGACGAAAGCATCCGAGGCTTGATGCTGCTGAAGCTCTTCACAAGGAAGCTGCAAAGGACACTGATGATGATGACATCCAGAGGAGGAG
GAGGAGGGCACAACCTGCAGAAAAGAAGTGGAGAGTTTGAAGAAGATGAACAAGGAATGAAAGTTGTACCAAATGATGTGAAGAGAGGGCAGTTTGCAGT
TACAGCAACCAAAGGTGGGAAACCAAAGAGATTCATCGTCGAGTTGGATGACCTGAACGATCCGGATTTCGTCAACTTGCTTGAACAGGCTGAGGACAAA
TTCGGGTTCCGGCAGGAAGGTGTACTTGAGGTCCCTTGTCACCCTGAGGAGCTTCAGAAGGTTCTAAGAGGAGGCAAGATTAGAAGAGCAAGTACAGAAT
GGTGA
AA sequence
>Lus10004014 pacid=23153342 polypeptide=Lus10004014 locus=Lus10004014.g ID=Lus10004014.BGIv1.0 annot-version=v1.0
MSSNDESIRGLMLLKLFTRKLQRTLMMMTSRGGGGGHNLQKRSGEFEEDEQGMKVVPNDVKRGQFAVTATKGGKPKRFIVELDDLNDPDFVNLLEQAEDK
FGFRQEGVLEVPCHPEELQKVLRGGKIRRASTEW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09870 SAUR-like auxin-responsive pro... Lus10004014 0 1
AT2G36830 TIP1;1, GAMMA-T... TONOPLAST INTRINSIC PROTEIN 1;... Lus10014411 1.0 0.9913
AT1G17200 Uncharacterised protein family... Lus10042471 1.4 0.9843
AT5G28010 Polyketide cyclase/dehydrase a... Lus10002174 2.6 0.9545
Lus10002266 6.0 0.9503
AT2G36830 TIP1;1, GAMMA-T... TONOPLAST INTRINSIC PROTEIN 1;... Lus10023913 6.0 0.9565
AT1G15260 unknown protein Lus10035880 6.7 0.9618
AT4G37070 AtPLAIVA, PLP1,... phospholipase A IVA, Acyl tran... Lus10019637 6.7 0.9622
AT5G16120 alpha/beta-Hydrolases superfam... Lus10017600 6.9 0.9485
AT2G25737 Sulfite exporter TauE/SafE fam... Lus10011682 7.3 0.9292
AT1G17200 Uncharacterised protein family... Lus10026196 7.7 0.9366

Lus10004014 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.