Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62880 43 / 5e-06 Cornichon family protein (.1.2) AT1G12390 0 / 1 Cornichon family protein (.1) AT1G12340 0 / 1 Cornichon family protein (.1) AT4G12090 0 / 1 Cornichon family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030270 [exp] 88 / 1e-23 AT1G12390 94 / 2e-26 Cornichon family protein (.1) Lus10028906 [exp] 49 / 7e-08 AT1G12390 207 / 2e-70 Cornichon family protein (.1) Lus10009295 [exp] 0 / 1 AT1G12390 142 / 7e-45 Cornichon family protein (.1) Lus10015866 [exp] 0 / 1 AT1G12390 128 / 1e-39 Cornichon family protein (.1) Lus10004320 [exp] 0 / 1 AT1G12390 173 / 1e-55 Cornichon family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G116100 [exp] 59 / 8e-12 AT1G12390 184 / 3e-61 Cornichon family protein (.1) Potri.002G148500 [exp] 41 / 3e-05 AT1G12390 106 / 9e-31 Cornichon family protein (.1) Potri.003G116400 [exp] 0 / 1 AT1G12390 182 / 2e-60 Cornichon family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03311 [flax] [poplar] Cornichon Cornichon protein
Representative CDS sequence Show only first row Show all	>Lus10004023 pacid=23153345 polypeptide=Lus10004023 locus=Lus10004023.g ID=Lus10004023.BGIv1.0 annot-version=v1.0 ATGGCTATTCAACTTCGTCTTCCTCATCGCCGTTGTCGCCATCGTCGGCTTCGAGTTAATGTGCTTGGCGGATCTGGAATTCGATCACATAAACCCATAC GATTCCGCTCGCCGGATAAACATGGTGGTGTTTCTGGAGTACATTACTCAGGCGACGATGTGCTTATCCTTTCTGTTTACCGGTCACTGGGTCTTCTGCC TCCTCTCCCTGCCTTACCTTTACTTCAATCTCACTCTAGGCGGCATTTGGTTGACGTGACGGGAATATACAAACAGCTGAACAGGGAGAAATTGCAGAGG CTTTACAAACTGGGTTACCTTGTGACTCTTTTTGTCCTTTCTTTGATCTGGTTGCTCTGGACCATCGTGAAGGAAGTTGATTAA
AA sequence Show only first row Show all	>Lus10004023 pacid=23153345 polypeptide=Lus10004023 locus=Lus10004023.g ID=Lus10004023.BGIv1.0 annot-version=v1.0 MAIQLRLPHRRCRHRRLRVNVLGGSGIRSHKPIRFRSPDKHGGVSGVHYSGDDVLILSVYRSLGLLPPLPALPLLQSHSRRHLVDVTGIYKQLNREKLQR LYKLGYLVTLFVLSLIWLLWTIVKEVD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G12340			Cornichon family protein (.1)		Lus10004023 [exp]	0	1
AT1G13120		EMB1745	embryo defective 1745 (.1)		Lus10001317 [exp]	5.7	0.7828
AT5G08180			Ribosomal protein L7Ae/L30e/S1...		Lus10040161 [exp]	10.8	0.8122
					Lus10032429 [exp]	12.4	0.7543
AT3G15790		MBD11, ATMBD11	methyl-CPG-binding domain 11 (...		Lus10002168 [exp]	15.9	0.8060
AT5G02130		NDP1	Tetratricopeptide repeat (TPR)...		Lus10024371 [exp]	18.4	0.8072
AT5G35390			Leucine-rich repeat protein ki...		Lus10027597 [exp]	19.0	0.7506
AT5G20510	Alfin	AL5	alfin-like 5 (.1)		Lus10015637 [exp]	19.4	0.7882
AT3G54900		ATGRXCP, CXIP1	GLUTAREDOXIN, CAX interacting ...		Lus10041501 [exp]	21.4	0.7586
AT1G17140		RIP1, ICR1	ROP INTERACTIVE PARTNER 1, int...		Lus10013708 [exp]	25.4	0.8056
AT4G15620			Uncharacterised protein family...		Lus10012562 [exp]	26.8	0.7875

Compare expression of checked genes

Lus10004023 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.