Lus10004024 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60820 190 / 4e-61 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000062 186 / 1e-60 AT3G60820 232 / 6e-79 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10015867 189 / 2e-60 AT3G60820 379 / 2e-135 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10009294 165 / 5e-47 AT1G48050 835 / 0.0 ARABIDOPSIS THALIANA KU80 HOMOLOG, Ku80 family protein (.1)
Lus10030271 86 / 2e-22 AT3G60820 82 / 3e-21 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10030272 86 / 5e-22 AT3G60820 81 / 2e-20 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G148300 174 / 1e-54 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.014G069800 169 / 5e-53 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF00227 Proteasome Proteasome subunit
Representative CDS sequence
>Lus10004024 pacid=23153361 polypeptide=Lus10004024 locus=Lus10004024.g ID=Lus10004024.BGIv1.0 annot-version=v1.0
ATGACGAGCAATCATGTCGAGGAATTTTTCTCCGTACGACAACAATGGCGGGTAGTTGTTCCTTCTTGCGCCTTTCTTAATCTCCTCCTCAACTGCTTCA
GTAGCGAGCCTCAACGAAATGAAAGGATTTTGCTCTCTGGCATGGTTTTGTTAATCTCTGCTAGGTCTTGCGTTGCGATTGCCGGAGCTGATTACTGTGT
GATTGCTTCTGATACTCGGATGTCCATTGGCTACAATATTCTCACCAGAGATCATTCCAAAGTATACAAACTGATCAGAAATGATGATCCAGTAAGCGGC
CTAGACAATGAAGGAAAGGGATGCGTTTACACATACGATGCTGTTGGTTCCTATGAGCGGGTCGGATACAGCGCCCAAGGTTCCGGTTCAGTACTCATCA
TGCCTTTCCTTGACAACCAATTGAAGTCTCCAAGCCCTCTCTTATTCCCTGCACAGGATGCTGTCACTCCATTTTCTGAATCCGAAGCGATCGATTTGGT
GAAAACCTGTTTCGCTTCTGCAACCGAGAGGGACATATACACCATAAGTGTCGGCGACAAGCTTGAAATAGTCGTGCTAAATGCTGACAGTATTCGTCGC
GAAGTTATGCGTATGGGGTTAGACTAG
AA sequence
>Lus10004024 pacid=23153361 polypeptide=Lus10004024 locus=Lus10004024.g ID=Lus10004024.BGIv1.0 annot-version=v1.0
MTSNHVEEFFSVRQQWRVVVPSCAFLNLLLNCFSSEPQRNERILLSGMVLLISARSCVAIAGADYCVIASDTRMSIGYNILTRDHSKVYKLIRNDDPVSG
LDNEGKGCVYTYDAVGSYERVGYSAQGSGSVLIMPFLDNQLKSPSPLLFPAQDAVTPFSESEAIDLVKTCFASATERDIYTISVGDKLEIVVLNADSIRR
EVMRMGLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G60820 PBF1 N-terminal nucleophile aminohy... Lus10004024 0 1
AT2G06040 unknown protein Lus10034779 8.5 0.7107
AT1G31430 Pentatricopeptide repeat (PPR-... Lus10002288 8.5 0.7590
AT1G56290 CwfJ-like family protein (.1) Lus10022209 11.1 0.7863
AT2G45620 Nucleotidyltransferase family ... Lus10015854 12.1 0.7858
AT3G52660 RNA-binding (RRM/RBD/RNP motif... Lus10021351 12.8 0.7737
AT1G67690 Zincin-like metalloproteases f... Lus10037058 20.1 0.7578
AT5G42920 AtTHO5 THO complex, subunit 5 (.1.2) Lus10009754 21.8 0.7639
AT1G80000 CASC3/Barentsz eIF4AIII bindin... Lus10011468 23.7 0.7484
AT5G66180 S-adenosyl-L-methionine-depend... Lus10028444 24.4 0.7531
AT2G36740 ATSWC2 sequence-specific DNA binding ... Lus10020396 32.7 0.7305

Lus10004024 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.