Plant FIBer expression Database

Lus10004034 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G37590 62 / 5e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020809
[exp]
287 / 7e-100 AT5G37590 94 / 2e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G085200
[exp]
121 / 8e-32 AT5G37590 530 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10004034 pacid=23156717 polypeptide=Lus10004034 locus=Lus10004034.g ID=Lus10004034.BGIv1.0 annot-version=v1.0
ATGTCGGAAACTACTGGTGTTCCAACGAATGCCGCCACCATGGCTCAACTAGCGAGGGCAGTGCTGGAAAATTTGGATTCACGAAGAAGCGTCAATCGTT
CCGAAGCAGTCCATCAATTAGAAAAGGCAAACGATCTCTTGAAGAAATCCATTAGGTATCGAGCTGGTTCACGGGTCGAATCGGTAGTAGAAGTGATTGT
TGACGATAAGGTTGCTTTCAACTTTGATGTATTGATATCACAAAAAGTCTTGGACAAAATCAGAAAGCCAACTGGAAGTAGACAAAAACATGGATCAACT
GAAGGAAGTAGACGGGAAGGACGCGTGGCCTTGATAACACTGCTGCAATCACTCGACTTTCTTGGTCTTTTAGAGATCAAACAGCAAGAGTTGCATGAAA
AAGAGCAGAAGAAGTATTCACCTGCTGCCGAGGCTGCACTTTCTCGGTGCATTTCTGTTTACAAAGAGTTCGAAGCTGAGAAATCGATTTCCGACTTCCC
TGAAGTAAAGGCGAAGTACCTGTCCTGCTTGAAGCGCCTGTCCGGTGATAAATCGAAATCAGCAGCCACTTTGGAAGAGCTTAACGATGAAATCAGGGGC
GTTGAAGCTGAAATTTCTCGCCACAAGGGTACCAAACCCTGA
AA sequence
>Lus10004034 pacid=23156717 polypeptide=Lus10004034 locus=Lus10004034.g ID=Lus10004034.BGIv1.0 annot-version=v1.0
MSETTGVPTNAATMAQLARAVLENLDSRRSVNRSEAVHQLEKANDLLKKSIRYRAGSRVESVVEVIVDDKVAFNFDVLISQKVLDKIRKPTGSRQKHGST
EGSRREGRVALITLLQSLDFLGLLEIKQQELHEKEQKKYSPAAEAALSRCISVYKEFEAEKSISDFPEVKAKYLSCLKRLSGDKSKSAATLEELNDEIRG
VEAEISRHKGTKP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G37590 Tetratricopeptide repeat (TPR)... Lus10004034
[exp]
0 1
AT1G67120 ATPases;nucleotide binding;ATP... Lus10037615
[exp]
2.0 0.8753
AT4G37340 CYP81D3 "cytochrome P450, family 81, s... Lus10024973
[exp]
2.8 0.8382
AT3G10530 Transducin/WD40 repeat-like su... Lus10032289
[exp]
4.9 0.8254
AT5G16020 GEX3 gamete-expressed 3 (.1) Lus10034090
[exp]
6.0 0.8485
Lus10043057
[exp]
6.7 0.8380
AT1G66930 Protein kinase superfamily pro... Lus10008362
[exp]
8.5 0.8399
AT5G48030 GFA2 gametophytic factor 2 (.1) Lus10011934
[exp]
10.2 0.8278
AT1G07380 Neutral/alkaline non-lysosomal... Lus10034565
[exp]
10.4 0.8373
AT4G21760 BGLU47 beta-glucosidase 47 (.1) Lus10032659
[exp]
11.0 0.8256
AT1G18010 Major facilitator superfamily ... Lus10043370
[exp]
12.6 0.8260

Lus10004034 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.