Lus10004065 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10004065 pacid=23156710 polypeptide=Lus10004065 locus=Lus10004065.g ID=Lus10004065.BGIv1.0 annot-version=v1.0
ATGGCAGCTCCATCGAGCTCAATCAGATCTCATCTTTCAAGCTCCGATCGCCTTCGCAACGCTCCGACGCCGGCAGCGGCGATGTCCGTGCCTCCTGATT
CGCTTCCAATTTCGGTGCCTCCGTCGCCATCTGTGAGCTCCCGTTCTCCACCATTTCCTCCGACACGAAGATTCGACAGCAGCTTCAACGATATGAATAT
ATCTAGCAGTAGAAGTGGTTTTGGAACTGGTTTTGGGTTTGGGTTGACCACTAATGTTGACTCGTTCCAACAAGTCAAAAGGTATGTTCTCAATCTTGAG
GTGCTAGTCGTATGA
AA sequence
>Lus10004065 pacid=23156710 polypeptide=Lus10004065 locus=Lus10004065.g ID=Lus10004065.BGIv1.0 annot-version=v1.0
MAAPSSSIRSHLSSSDRLRNAPTPAAAMSVPPDSLPISVPPSPSVSSRSPPFPPTRRFDSSFNDMNISSSRSGFGTGFGFGLTTNVDSFQQVKRYVLNLE
VLVV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10004065 0 1
AT5G08560 transducin family protein / WD... Lus10001412 4.2 0.8115
AT5G55840 Pentatricopeptide repeat (PPR)... Lus10038697 4.6 0.7498
AT2G34930 disease resistance family prot... Lus10039523 13.9 0.7267
AT5G46060 Protein of unknown function, D... Lus10005267 15.1 0.7820
AT4G14180 ATPRD1 putative recombination initiat... Lus10003912 19.4 0.7722
AT2G34930 disease resistance family prot... Lus10039522 22.7 0.7152
AT4G33590 unknown protein Lus10036463 39.6 0.7547
Lus10029790 44.4 0.7727
AT4G40080 ENTH/ANTH/VHS superfamily prot... Lus10002642 55.7 0.7136
AT3G09410 Pectinacetylesterase family pr... Lus10025347 74.6 0.7325

Lus10004065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.