Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51590 51 / 3e-09 LTP12 lipid transfer protein 12 (.1) AT2G38540 50 / 9e-09 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT5G59320 49 / 1e-08 LTP3 lipid transfer protein 3 (.1) AT2G38530 47 / 2e-07 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT5G59310 45 / 8e-07 LTP4 lipid transfer protein 4 (.1) AT2G15050 44 / 9e-07 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT2G18370 42 / 9e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G08770 41 / 2e-05 LTP6 lipid transfer protein 6 (.1.2) AT2G44300 39 / 0.0002 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G51600 37 / 0.0004 LTP5 lipid transfer protein 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004068 [exp] 114 / 2e-34 AT3G51590 43 / 9e-07 lipid transfer protein 12 (.1) Lus10025234 [exp] 57 / 2e-11 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10025151 [exp] 56 / 7e-11 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10026418 [exp] 55 / 1e-10 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10022745 [exp] 54 / 2e-10 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10025231 [exp] 53 / 5e-10 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10014167 [exp] 51 / 4e-09 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10007280 [exp] 51 / 5e-09 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10029226 [exp] 50 / 6e-09 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G135800 [exp] 43 / 3e-06 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086600 [exp] 42 / 9e-06 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086500 [exp] 42 / 1e-05 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 41 / 2e-05 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 41 / 2e-05 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G108100 [exp] 39 / 7e-05 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232900 [exp] 39 / 0.0002 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135400 [exp] 38 / 0.0002 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.006G195700 [exp] 38 / 0.0004 AT2G44290 145 / 6e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G046500 [exp] 37 / 0.0004 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004067 pacid=23156748 polypeptide=Lus10004067 locus=Lus10004067.g ID=Lus10004067.BGIv1.0 annot-version=v1.0 ATGGCGGCCGCCGTCGAACCATTTCTGCCGTCTACAAGCAGTGGTTCTATAAGCTACTGGGCCTTTTTCCACTGCAACGAGCGGGTAGCTGGTCTGGAAC CATGCATGCCCTACGTGACCGGAAAGGTGGGACCCATCGTCCCGGCTCGGTGTTGCCACGCTGTCAAGTCCTTCTTTGACGGCGTCGCCACGTCAGATAA GCGCTACAAGCGGTGTTTGTGCTGGGAGCAGTTCCCGCGCACAAGTCCGAAACTCGGTGCAGCGCTCGTGGACCGAATCCCTTCTGGCTGCGGATTCAAC GTCCCTAGGGACATCACTAGCCCCAACAATTGCCCCAAGTACTGA
AA sequence Show only first row Show all	>Lus10004067 pacid=23156748 polypeptide=Lus10004067 locus=Lus10004067.g ID=Lus10004067.BGIv1.0 annot-version=v1.0 MAAAVEPFLPSTSSGSISYWAFFHCNERVAGLEPCMPYVTGKVGPIVPARCCHAVKSFFDGVATSDKRYKRCLCWEQFPRTSPKLGAALVDRIPSGCGFN VPRDITSPNNCPKY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10004067 [exp]	0	1
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10000558 [exp]	1.0	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10005482 [exp]	2.0	1.0000
					Lus10011636 [exp]	2.4	1.0000
AT3G16970			Plant self-incompatibility pro...		Lus10011753 [exp]	2.8	1.0000
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10011892 [exp]	3.2	1.0000
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10022473 [exp]	3.5	1.0000
AT4G10950			SGNH hydrolase-type esterase s...		Lus10023070 [exp]	3.7	1.0000
AT1G34575			FAD-binding Berberine family p...		Lus10023373 [exp]	4.0	1.0000
AT2G02340		ATPP2-B8	phloem protein 2-B8 (.1)		Lus10025662 [exp]	4.2	1.0000
AT4G27570			UDP-Glycosyltransferase superf...		Lus10013368 [exp]	4.5	1.0000

Compare expression of checked genes

Lus10004067 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.