Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51590 43 / 1e-06 LTP12 lipid transfer protein 12 (.1) AT5G59320 41 / 6e-06 LTP3 lipid transfer protein 3 (.1) AT2G38540 41 / 7e-06 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT2G38530 38 / 0.0001 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT5G59310 37 / 0.0002 LTP4 lipid transfer protein 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004067 [exp] 114 / 1e-34 AT3G51590 51 / 3e-09 lipid transfer protein 12 (.1) Lus10025151 [exp] 52 / 6e-10 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10025234 [exp] 48 / 1e-08 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10026418 [exp] 48 / 2e-08 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10025231 [exp] 47 / 6e-08 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10014167 [exp] 43 / 2e-06 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10022745 [exp] 42 / 3e-06 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10007280 [exp] 40 / 1e-05 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10009911 [exp] 39 / 5e-05 AT5G59320 72 / 4e-17 lipid transfer protein 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G046500 [exp] 42 / 4e-06 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.004G086600 [exp] 39 / 5e-05 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086500 [exp] 38 / 0.0001 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 36 / 0.0006 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.016G135800 [exp] 36 / 0.0007 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004068 pacid=23156741 polypeptide=Lus10004068 locus=Lus10004068.g ID=Lus10004068.BGIv1.0 annot-version=v1.0 ATGCCTTACGTGGCCGGGAAGGTGGGACCCGCAGTTCCTGCTCGGTGTTGCCACGCTGCTAAGTCCTTTTTTCACCGCGCTGCCACGTTATTCGAACGCT ACGAGCGCTGTGTGTGCTGGACGAAATTTGCCAGCCTAAGTCCCAACCTCGGTGAAGCCCTCGTCTCCCGAATCCCTGCTGCATGCGGATTCAAGGTCCC TATGGATATCACCAGCCCCGCCAATTGTCCCCCCAAGCACTGA
AA sequence Show only first row Show all	>Lus10004068 pacid=23156741 polypeptide=Lus10004068 locus=Lus10004068.g ID=Lus10004068.BGIv1.0 annot-version=v1.0 MPYVAGKVGPAVPARCCHAAKSFFHRAATLFERYERCVCWTKFASLSPNLGEALVSRIPAACGFKVPMDITSPANCPPKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10004068 [exp]	0	1
					Lus10005297 [exp]	3.6	0.9163
AT5G53910			RING/U-box superfamily protein...		Lus10011380 [exp]	5.1	0.9163
					Lus10013260 [exp]	6.2	0.9163
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10015614 [exp]	7.2	0.9163
					Lus10006529 [exp]	8.1	0.9163
					Lus10035557 [exp]	8.8	0.9163
AT3G52490			Double Clp-N motif-containing ...		Lus10024536 [exp]	9.5	0.9163
AT2G06090			Plant self-incompatibility pro...		Lus10011896 [exp]	10.2	0.9163
AT3G26770			NAD(P)-binding Rossmann-fold s...		Lus10014228 [exp]	11.6	0.9119
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10032426 [exp]	11.8	0.9003

Compare expression of checked genes

Lus10004068 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.