Lus10004071 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71080 171 / 1e-53 RNA polymerase II transcription elongation factor (.1)
AT5G38050 148 / 5e-45 RNA polymerase II transcription elongation factor (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009106 237 / 3e-79 AT5G38050 196 / 4e-61 RNA polymerase II transcription elongation factor (.1)
Lus10042948 182 / 4e-57 AT1G71080 281 / 7e-93 RNA polymerase II transcription elongation factor (.1)
Lus10032448 179 / 3e-56 AT1G71080 280 / 5e-93 RNA polymerase II transcription elongation factor (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G114900 188 / 2e-60 AT1G71080 286 / 1e-95 RNA polymerase II transcription elongation factor (.1)
Potri.004G092200 186 / 5e-59 AT1G71080 194 / 2e-59 RNA polymerase II transcription elongation factor (.1)
Potri.008G127900 184 / 6e-59 AT1G71080 285 / 1e-95 RNA polymerase II transcription elongation factor (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09816 EAF RNA polymerase II transcription elongation factor
Representative CDS sequence
>Lus10004071 pacid=23156712 polypeptide=Lus10004071 locus=Lus10004071.g ID=Lus10004071.BGIv1.0 annot-version=v1.0
ATGGCGAACATCAACAACGAAGAACCCAGCACTGCTCCACAGCCTGATCGCTGGTACGATCTTACCCTAGGCCCATCCTTTACTGATCACTCAAAGTACT
GTACTTTACGCTATGATTTCAAGCCGGCGTCGATCGATAAGAGCGAGCCAGGAATGCTCCACAAGGACAGCAACAAGAGAGTAACGGTGGAGTACAACAA
CAACCAACCAGGGAAATCAAAGCTCGTCTTTGAAGGTGTGAGTGAGGATTACAAAGAGAACGACGCCGTTCTCTTCTTCGACGGCCGTTCCTTTCGCCTT
GAACGCCTCCACCGTGCCGTGAAGCGCCTCAGACATGTCCGGCTGCCGGGAGATCCTGCAGCTGCTGCAACGTTGGTGGCGGCTACTACTCCCCCCTCCC
CCTCCACTTGCTGCTGCTGA
AA sequence
>Lus10004071 pacid=23156712 polypeptide=Lus10004071 locus=Lus10004071.g ID=Lus10004071.BGIv1.0 annot-version=v1.0
MANINNEEPSTAPQPDRWYDLTLGPSFTDHSKYCTLRYDFKPASIDKSEPGMLHKDSNKRVTVEYNNNQPGKSKLVFEGVSEDYKENDAVLFFDGRSFRL
ERLHRAVKRLRHVRLPGDPAAAATLVAATTPPSPSTCCC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G71080 RNA polymerase II transcriptio... Lus10004071 0 1
AT1G06450 Polynucleotidyl transferase, r... Lus10017895 5.7 0.7320
AT1G20830 MCD1 multiple chloroplast division ... Lus10030727 6.1 0.7485
AT3G06330 RING/U-box superfamily protein... Lus10033985 9.6 0.7459
AT5G07580 AP2_ERF Integrase-type DNA-binding sup... Lus10042995 9.6 0.7369
AT1G29350 Kinase-related protein of unkn... Lus10000188 11.2 0.7287
AT5G52030 TraB family protein (.1.2) Lus10015005 15.2 0.7217
AT5G19590 Protein of unknown function, D... Lus10033088 16.2 0.7261
AT4G39680 SAP domain-containing protein ... Lus10016433 19.1 0.7225
AT3G04690 ANX1 ANXUR1, Malectin/receptor-like... Lus10016907 26.4 0.6730
AT1G75340 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10040567 30.7 0.6734

Lus10004071 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.