Lus10004083 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATMG00080 154 / 8e-50 ATMG00080.1, RPL16 ribosomal protein L16 (.1)
ATCG00790 72 / 7e-18 ATCG00790.1, RPL16 ribosomal protein L16 (.1)
AT2G28830 68 / 7e-15 AtPUB12 PLANT U-BOX 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Representative CDS sequence
>Lus10004083 pacid=23169970 polypeptide=Lus10004083 locus=Lus10004083.g ID=Lus10004083.BGIv1.0 annot-version=v1.0
ATGAGCGGACAATTCCGAAGAAATGGTAAGATATGCGTAAGAGTTCTAGCGGATCTCCCTATTATCGGGAAACCTACAGAAGTAAGAATGGGGAGAGGAA
AAGGAAATCCTATGGGTTGGATTGCTCGTGTGTCCATGGGACAAATCCTATTTGAAATGGATGGTGTGAGTTTGTCAAATGCTCGACAAGCCGCTACATT
AGCGGAGCATAAACCATGTTCGTCAACCAAGTTTGTTCAGTGGTCGTAA
AA sequence
>Lus10004083 pacid=23169970 polypeptide=Lus10004083 locus=Lus10004083.g ID=Lus10004083.BGIv1.0 annot-version=v1.0
MSGQFRRNGKICVRVLADLPIIGKPTEVRMGRGKGNPMGWIARVSMGQILFEMDGVSLSNARQAATLAEHKPCSSTKFVQWS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
ATMG00080 ATMG00080.1, RP... ribosomal protein L16 (.1) Lus10004083 0 1
ATMG00510 ATMG00510.1, NA... NADH dehydrogenase subunit 7 (... Lus10000460 2.4 0.9853
ATMG00650 ATMG00650.1, NA... NADH dehydrogenase subunit 4L ... Lus10004838 3.7 0.9812
ATMG00510 ATMG00510.1, NA... NADH dehydrogenase subunit 7 (... Lus10015033 4.6 0.9806
ATMG00510 ATMG00510.1, NA... NADH dehydrogenase subunit 7 (... Lus10009720 5.3 0.9802
ATMG00510 ATMG00510.1, NA... NADH dehydrogenase subunit 7 (... Lus10000459 5.9 0.9800
AT2G07675 Ribosomal protein S12/S23 fami... Lus10002330 6.0 0.9746
AT3G02260 CRM1, TIR3, LPR... UMBRELLA 1, TRANSPORT INHIBITO... Lus10000087 6.5 0.9772
ATMG01360 ATMG01360.1, CO... cytochrome oxidase (.1) Lus10009204 7.5 0.9760
ATMG01360 ATMG01360.1, CO... cytochrome oxidase (.1) Lus10004084 8.0 0.9750
AT3G63460 EMB2221 transducin family protein / WD... Lus10016374 10.2 0.9628

Lus10004083 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.