Lus10004096 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52450 95 / 1e-22 PUB22 plant U-box 22 (.1)
AT2G35930 91 / 3e-21 PUB23 plant U-box 23 (.1)
AT1G49780 81 / 7e-18 PUB26 plant U-box 26 (.1)
AT3G19380 81 / 2e-17 PUB25 plant U-box 25 (.1)
AT5G09800 79 / 4e-17 ARM repeat superfamily protein (.1)
AT3G18710 77 / 2e-16 ATPUB29 ARABIDOPSIS THALIANA PLANT U-BOX 29, plant U-box 29 (.1)
AT5G64660 77 / 2e-16 ATCMPG2 "CYS, MET, PRO, and GLY protein 2", CYS, MET, PRO, and GLY protein 2 (.1)
AT1G66160 77 / 2e-16 ATCMPG1 "CYS, MET, PRO, and GLY protein 1", CYS, MET, PRO, and GLY protein 1 (.1.2)
AT3G11840 74 / 2e-15 PUB24 plant U-box 24 (.1)
AT1G23030 73 / 8e-15 PUB11 ARM repeat superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029393 98 / 1e-23 AT3G52450 462 / 1e-161 plant U-box 22 (.1)
Lus10016166 94 / 4e-22 AT3G52450 462 / 2e-161 plant U-box 22 (.1)
Lus10021267 92 / 2e-21 AT2G35930 474 / 5e-167 plant U-box 23 (.1)
Lus10013584 89 / 2e-20 AT2G35930 471 / 2e-165 plant U-box 23 (.1)
Lus10040124 82 / 4e-19 AT1G66160 154 / 6e-45 "CYS, MET, PRO, and GLY protein 1", CYS, MET, PRO, and GLY protein 1 (.1.2)
Lus10001079 85 / 5e-19 AT5G37490 290 / 1e-93 ARM repeat superfamily protein (.1)
Lus10004191 84 / 1e-18 AT3G11840 300 / 2e-95 plant U-box 24 (.1)
Lus10029395 81 / 2e-17 AT3G11840 296 / 8e-96 plant U-box 24 (.1)
Lus10043471 77 / 2e-16 AT1G71020 682 / 0.0 ARM repeat superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G016200 108 / 1e-27 AT2G35930 475 / 4e-167 plant U-box 23 (.1)
Potri.001G216100 106 / 6e-27 AT2G35930 452 / 5e-158 plant U-box 23 (.1)
Potri.016G069400 94 / 2e-22 AT3G52450 511 / 0.0 plant U-box 22 (.1)
Potri.006G202600 91 / 3e-21 AT3G52450 511 / 0.0 plant U-box 22 (.1)
Potri.016G069500 85 / 4e-19 AT3G11840 367 / 7e-124 plant U-box 24 (.1)
Potri.006G202700 85 / 4e-19 AT3G11840 362 / 3e-122 plant U-box 24 (.1)
Potri.002G174500 84 / 7e-19 AT2G35930 249 / 9e-79 plant U-box 23 (.1)
Potri.014G101100 84 / 7e-19 AT2G35930 266 / 3e-85 plant U-box 23 (.1)
Potri.004G083900 83 / 2e-18 AT5G37490 354 / 8e-119 ARM repeat superfamily protein (.1)
Potri.015G031000 83 / 2e-18 AT5G37490 323 / 9e-107 ARM repeat superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF04564 U-box U-box domain
Representative CDS sequence
>Lus10004096 pacid=23147816 polypeptide=Lus10004096 locus=Lus10004096.g ID=Lus10004096.BGIv1.0 annot-version=v1.0
ATGGAGGAGCTTCCTCATTCGTCGGCCGACGACGTCCCCTACCATTTCCTCTGCCCAATCTCCCTTCAGCTAATGTCCGACCCCGTCACCCTCTCCACTG
GCATCACCTACGACCGCCACCACATCCACCGCTGGCTCTTCTCCCCCCCCCGCCACACCTGCCCCGTCACCAACCAAATCCTCTCCTTCAAACTCCTCAC
CCCTAATCTCACCCTCCGCCGCCTCATCCAATCTTCAACCACCACCGCCGCCGCCACCACCACCACCTCCCCCGACTCTCGCTTCCGCTGTCCGACCCCG
TCACCCTCTCCACTGGCATCACCTACGACCGCCACCACATCCACCGCTGGCTCTTCTCCCTCAACCGCCACACCTGCCCCGTCACCAACCAAATCCTCTC
CTTCAAACTCCTCACCCCTAATCTCACCCTCCGCCGCCTCACCCATCCCCCCCCCCCCCCCGCCCCCGCCACCACCACCACCTCCCCCGAATCTCGCCTC
CGATCTTCTTCTTCACTCACAATCGAAGCCGAGCCGAGCCGAGCCAGCCTCGATTTCCACGCTTCGGTCATCACGAGAAGCCGAGCCGATGAGGATCAGG
AAGCCGAGCCGAGTGGGAGTGGTCAATCGGTTGAAGAATCGTTGCAGATTTTGA
AA sequence
>Lus10004096 pacid=23147816 polypeptide=Lus10004096 locus=Lus10004096.g ID=Lus10004096.BGIv1.0 annot-version=v1.0
MEELPHSSADDVPYHFLCPISLQLMSDPVTLSTGITYDRHHIHRWLFSPPRHTCPVTNQILSFKLLTPNLTLRRLIQSSTTTAAATTTTSPDSRFRCPTP
SPSPLASPTTATTSTAGSSPSTATPAPSPTKSSPSNSSPLISPSAASPIPPPPPPPPPPPPPPNLASDLLLHSQSKPSRAEPASISTLRSSREAEPMRIR
KPSRVGVVNRLKNRCRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52450 PUB22 plant U-box 22 (.1) Lus10004096 0 1
AT2G35930 PUB23 plant U-box 23 (.1) Lus10004095 1.0 0.8523
AT1G15020 QSO2, ATQSOX1 quiescin-sulfhydryl oxidase 1 ... Lus10034639 5.7 0.8282
AT3G61590 HWS, HS HAWAIIAN SKIRT, Galactose oxid... Lus10007855 17.9 0.7521
AT1G16780 AtVHP2;2, AVPL1 Inorganic H pyrophosphatase fa... Lus10034800 20.2 0.8316
AT1G48270 GCR1 G-protein-coupled receptor 1 (... Lus10018333 24.2 0.8078
AT1G18260 HRD3A, EBS5 EMS-mutagenized bri1 suppresso... Lus10009042 25.9 0.8084
AT5G37790 Protein kinase superfamily pro... Lus10028518 26.5 0.7971
AT1G71070 Core-2/I-branching beta-1,6-N-... Lus10012710 34.5 0.8235
AT4G27950 AP2_ERF CRF4 cytokinin response factor 4 (.... Lus10039324 37.1 0.7942
AT1G74030 ENO1 enolase 1 (.1) Lus10038963 38.5 0.8110

Lus10004096 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.