Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47980 47 / 5e-07 HXXXD-type acyl-transferase family protein (.1) AT1G24430 45 / 2e-06 HXXXD-type acyl-transferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036042 [exp] 90 / 1e-22 AT4G15390 151 / 1e-42 HXXXD-type acyl-transferase family protein (.1) Lus10036043 [exp] 86 / 2e-20 AT3G26040 205 / 4e-61 HXXXD-type acyl-transferase family protein (.1) Lus10005361 [exp] 86 / 2e-20 AT3G26040 213 / 9e-64 HXXXD-type acyl-transferase family protein (.1) Lus10021391 [exp] 76 / 5e-17 AT3G26040 191 / 2e-55 HXXXD-type acyl-transferase family protein (.1) Lus10021392 [exp] 76 / 7e-17 AT3G26040 184 / 6e-53 HXXXD-type acyl-transferase family protein (.1) Lus10021387 [exp] 72 / 2e-15 AT3G26040 206 / 3e-61 HXXXD-type acyl-transferase family protein (.1) Lus10026013 [exp] 65 / 6e-13 AT3G26040 194 / 5e-57 HXXXD-type acyl-transferase family protein (.1) Lus10004441 [exp] 61 / 1e-11 AT3G26040 196 / 2e-57 HXXXD-type acyl-transferase family protein (.1) Lus10017468 [exp] 60 / 2e-11 AT3G26040 207 / 5e-62 HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G034300 [exp] 70 / 6e-15 AT3G26040 280 / 1e-89 HXXXD-type acyl-transferase family protein (.1) Potri.008G033500 [exp] 64 / 1e-12 AT3G26040 290 / 3e-93 HXXXD-type acyl-transferase family protein (.1) Potri.008G034100 [exp] 63 / 2e-12 AT3G26040 270 / 4e-86 HXXXD-type acyl-transferase family protein (.1) Potri.002G010700 [exp] 50 / 4e-08 AT3G26040 306 / 3e-100 HXXXD-type acyl-transferase family protein (.1) Potri.011G124128 [exp] 47 / 5e-07 AT3G26040 282 / 1e-90 HXXXD-type acyl-transferase family protein (.1) Potri.011G124300 [exp] 47 / 5e-07 AT3G26040 278 / 5e-89 HXXXD-type acyl-transferase family protein (.1) Potri.011G124184 [exp] 47 / 5e-07 AT3G26040 278 / 5e-89 HXXXD-type acyl-transferase family protein (.1) Potri.011G124156 [exp] 47 / 5e-07 AT3G26040 284 / 2e-91 HXXXD-type acyl-transferase family protein (.1) Potri.001G310000 [exp] 47 / 7e-07 AT3G26040 249 / 5e-78 HXXXD-type acyl-transferase family protein (.1) Potri.011G124268 [exp] 47 / 7e-07 AT3G26040 281 / 2e-90 HXXXD-type acyl-transferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0149 [flax] [poplar] CoA-acyltrans PF02458 [flax] [poplar] Transferase Transferase family
Representative CDS sequence Show only first row Show all	>Lus10004112 pacid=23147806 polypeptide=Lus10004112 locus=Lus10004112.g ID=Lus10004112.BGIv1.0 annot-version=v1.0 ATGGACGGAGTCACGTCAAGCGCTTTCCTCAGAACCTGGGCCACAGTCAACGCTAGTCAACTTGACAAAGTAGTGGAGCCCAATTTCGTGGAAGGCCCAA TCACGACACCCGCCCCACCACCTCGCGACTACGGGTCACTCAACGAAAGACTCTGGTTCGGAGGAGGTGGAGGGGAGGAGTCATCGTCGTTGAAGGCCAA TCTCGTAACGAGGAGATTCGTGTTTGATGCCGAGTCAGTAGCGAAAATAAAGGTGCTGGCCAAGGGCAAAACCATCACCAACACTACTCATGCAGAGGCG GTGTCGACTTTCATTCGGAAGTCCTTATTAACATCCGGACCTACAATAACATACCCAACCCTTCTGTTTCAAATTAGAGCGTTGACCTGA
AA sequence Show only first row Show all	>Lus10004112 pacid=23147806 polypeptide=Lus10004112 locus=Lus10004112.g ID=Lus10004112.BGIv1.0 annot-version=v1.0 MDGVTSSAFLRTWATVNASQLDKVVEPNFVEGPITTPAPPPRDYGSLNERLWFGGGGGEESSSLKANLVTRRFVFDAESVAKIKVLAKGKTITNTTHAEA VSTFIRKSLLTSGPTITYPTLLFQIRALT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47980			HXXXD-type acyl-transferase fa...		Lus10004112 [exp]	0	1

Compare expression of checked genes

Lus10004112 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.