Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13880 78 / 1e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G77170 76 / 5e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G04840 75 / 1e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G18840 74 / 2e-16 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G68930 74 / 3e-16 pentatricopeptide (PPR) repeat-containing protein (.1) AT3G53360 74 / 3e-16 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G08070 73 / 4e-16 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G34400 72 / 1e-15 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT4G18750 71 / 3e-15 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G56550 71 / 3e-15 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014009 [exp] 176 / 5e-58 AT3G13880 89 / 2e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10019213 [exp] 188 / 6e-58 AT2G21090 376 / 2e-123 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10004303 [exp] 169 / 5e-54 AT2G21090 146 / 1e-40 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10003383 [exp] 166 / 3e-53 AT2G21090 145 / 1e-40 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10012796 [exp] 74 / 4e-16 AT2G36980 516 / 1e-178 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10022890 [exp] 74 / 4e-16 AT3G61170 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10024936 [exp] 72 / 2e-15 AT3G61170 855 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10017032 [exp] 72 / 2e-15 AT4G32430 844 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10028953 [exp] 71 / 4e-15 AT5G47460 541 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G108000 [exp] 81 / 1e-18 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.013G103600 [exp] 80 / 2e-18 AT1G08070 477 / 7e-160 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G064301 [exp] 71 / 7e-17 AT2G34400 170 / 7e-51 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.001G369900 [exp] 76 / 8e-17 AT5G66520 512 / 2e-175 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G184800 [exp] 75 / 9e-17 AT2G27610 1061 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.008G121400 [exp] 75 / 1e-16 AT1G13410 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.008G106500 [exp] 74 / 2e-16 AT2G29760 422 / 4e-139 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G164100 [exp] 74 / 3e-16 AT1G77170 553 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G244500 [exp] 74 / 3e-16 AT3G15130 891 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G041650 [exp] 72 / 3e-16 AT2G34400 226 / 6e-70 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10004114 pacid=23157529 polypeptide=Lus10004114 locus=Lus10004114.g ID=Lus10004114.BGIv1.0 annot-version=v1.0 ATGCCTGAACGAAATCTCGTCAGCTACAACTCAATGATTTCGGGCCTTCCTCGTGGTGGGTGTTACACGGAGGCGTTGGGTATGTTCATGAGGTTGCAGG AAGATTGCGTTGGTGGGTTTTGTTTGGATGAGTTTACTGTTGCGAGTGTGGTGAGTTGTTGTGCGAGCTTTCGTGGGTTGGGACTGGTTCGTCAGCTGCA TGGTGTGGGATTAGTTCTTGGGCTGGAAAAGAATCTGGTGTTGCTAAATTCCTTGATTGATGCCTATGGGAAAGGTGGAGAATTCGATTTTAGTCTCCGT GTGTTTCGCAGGATGAATGAAAGGGATGTTGTTTCATGGACATCAATGGTGGCTGCTTATACTCCATCATCCTGA
AA sequence Show only first row Show all	>Lus10004114 pacid=23157529 polypeptide=Lus10004114 locus=Lus10004114.g ID=Lus10004114.BGIv1.0 annot-version=v1.0 MPERNLVSYNSMISGLPRGGCYTEALGMFMRLQEDCVGGFCLDEFTVASVVSCCASFRGLGLVRQLHGVGLVLGLEKNLVLLNSLIDAYGKGGEFDFSLR VFRRMNERDVVSWTSMVAAYTPSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G13880			Tetratricopeptide repeat (TPR)...		Lus10004114 [exp]	0	1
AT5G23210		SCPL34	serine carboxypeptidase-like 3...		Lus10010191 [exp]	5.7	0.7880
AT4G28400			Protein phosphatase 2C family ...		Lus10028094 [exp]	6.9	0.8443
AT4G12720		ATNUDX7, GFG1, ...	GROWTH FACTOR GENE 1, Arabidop...		Lus10006365 [exp]	7.7	0.8330
AT5G61210		SNP33, ATSNAP33...	soluble N-ethylmaleimide-sensi...		Lus10003466 [exp]	9.4	0.8425
AT5G37710			alpha/beta-Hydrolases superfam...		Lus10010983 [exp]	11.0	0.8211
AT5G37710			alpha/beta-Hydrolases superfam...		Lus10000445 [exp]	11.1	0.8315
AT1G23450			Tetratricopeptide repeat (TPR)...		Lus10029138 [exp]	18.3	0.7115
AT3G45640		ATMAPK3, ATMPK3	mitogen-activated protein kina...		Lus10036136 [exp]	19.0	0.8061
AT4G33780			unknown protein		Lus10037250 [exp]	21.6	0.8177
AT2G46330		ATAGP16, AGP16	arabinogalactan protein 16 (.1...		Lus10023629 [exp]	24.5	0.8101

Compare expression of checked genes

Lus10004114 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.